SecReT4
Protein ID: 294010447
T4SS name [ID]VirB [28]
Gene symbolvirB8
Locus tagSJA_C1-04610
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]470758..471456 [-]
Producttype IV secretory pathway VirB8 component
Component typeVirB8
UniProt IDD4YY63
KEGG IDsjp:SJA_C1-04610
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-61, Aligned region: 22..229
Protein Sequence: 232 a.a.     [Download]
>gi|294010447|ref|YP_003543907.1| type IV secretory pathway VirB8 component [Sphingobium japonicum UT26S]
MRAADDRSEAVPASGLQRYFRDARSWDQDRIRNALRSTRIAWSIAAIASLLAAASIFAVAALTPLKTVVP
YVIRVNQTTGAVDVQTALTQRPMRYDEAVTKYFLAQYVRTRESWIPAAAEENFRFVTILSQPTEQQRWAR
FYSSNNGASPQNVWGKNAVVQARVRNIAFINDRVANVRFTRTVQTETDVQNSDWIATITFAYANAPMAEG
DRYRNPLGFQVENYRADPEVIR
 
Nucleotide Sequence: 699 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c471456-470758 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGCGAGCTGCTGATGACCGCTCGGAGGCCGTGCCGGCATCGGGGCTGCAGCGCTATTTCCGGGACGCAC
GAAGCTGGGATCAGGACAGGATCCGGAACGCGCTGCGCTCGACCCGCATCGCTTGGAGCATCGCGGCCAT
CGCCTCACTCCTGGCCGCGGCCTCGATCTTCGCAGTTGCGGCTCTGACACCTCTCAAGACTGTCGTGCCC
TATGTTATTCGCGTCAACCAGACCACCGGCGCGGTGGATGTCCAGACCGCGCTCACCCAGCGGCCGATGC
GCTACGATGAGGCGGTCACCAAATACTTCCTCGCCCAGTATGTGAGAACCCGCGAAAGCTGGATCCCGGC
AGCGGCCGAAGAAAATTTTCGGTTCGTGACGATCCTCTCGCAACCGACTGAACAGCAGCGCTGGGCGCGC
TTCTACAGCAGCAACAATGGCGCAAGTCCCCAAAATGTTTGGGGCAAGAATGCCGTCGTGCAAGCGCGCG
TGCGCAACATCGCCTTCATCAACGATCGCGTCGCCAATGTGCGGTTCACGCGGACGGTCCAGACCGAGAC
CGACGTTCAGAACAGCGATTGGATCGCCACGATCACGTTCGCCTACGCCAACGCGCCCATGGCGGAAGGC
GATCGCTACCGGAACCCGCTGGGATTCCAGGTCGAAAACTATCGTGCCGATCCGGAGGTGATCCGATGA
 Primer design