SecReT4
Protein ID: 294011977
T4SS name [ID]Trb [310]
Gene symbolvirB9
Locus tagSJA_C1-19910
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]1988465..1989532 [-]
Producttype IV secretory pathway VirB9 component
Component typeTrbG
UniProt IDD4Z2J3
KEGG IDsjp:SJA_C1-19910
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-70, Aligned region: 124..348
Protein Sequence: 355 a.a.     [Download]
>gi|294011977|ref|YP_003545437.1| type IV secretory pathway VirB9 component [Sphingobium japonicum UT26S]
MTPALHKAAPWSAGRPAFLINAIPAFRKSGLPLLLLYTSALAGCAGHMPPPEISYDDAMPAVQAADPPKP
VQIVELPKPLPLPGQLKPVGKDAKPEPEAVDPTARVNQANAAARVQPVRNGFINSMQVYPFVDGALYQVY
ASPGQITDIGLQPGEQLVGSGPVAAGDTVRWIIGDTESGTGAAKQVHILVKPTRADLMTNLVINTDRRTY
HMELRSTPTTYMASVSWQYPQDQLIALRRQNQQAEATQPVANGIDLARVNFRYEVTGDRAPWRPLRAFDD
GKQIFIEFPRGIGQGEMPPLFVVGPEGDTSELVNYRVRGNYMIVDRLFAAAELRFGADKNQKRVRISRTD
GRPAS
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c1989532-1988465 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGACGCCAGCACTCCACAAAGCCGCCCCCTGGAGTGCAGGGCGTCCGGCTTTCCTCATCAACGCCATTC
CGGCTTTCCGTAAATCCGGCTTGCCGCTTCTCCTGCTTTACACCTCGGCGCTCGCCGGATGCGCTGGCCA
CATGCCGCCGCCGGAAATCTCCTACGACGACGCCATGCCCGCCGTGCAGGCCGCCGATCCGCCCAAGCCG
GTGCAGATCGTGGAGTTGCCGAAACCACTACCGCTTCCCGGACAGTTGAAGCCTGTCGGCAAGGATGCCA
AGCCCGAGCCGGAAGCCGTCGATCCGACCGCGCGGGTCAACCAGGCCAATGCGGCCGCGCGCGTGCAGCC
GGTACGCAACGGCTTCATCAATTCGATGCAGGTCTATCCCTTCGTCGATGGCGCCCTCTATCAGGTCTAT
GCCTCGCCGGGACAGATCACCGACATCGGCCTCCAGCCTGGCGAACAGCTCGTGGGTTCTGGCCCTGTCG
CCGCCGGCGACACCGTGCGCTGGATCATCGGCGACACCGAGAGCGGGACGGGTGCGGCCAAGCAGGTCCA
TATCCTCGTCAAACCGACGCGCGCCGACCTCATGACGAATCTCGTCATCAATACCGACCGCCGCACCTAT
CATATGGAATTGCGCTCGACGCCCACGACCTACATGGCGTCGGTATCCTGGCAATATCCGCAAGACCAGC
TCATCGCGCTGCGCCGTCAGAACCAACAGGCGGAGGCCACGCAGCCCGTTGCGAACGGCATCGATCTCGC
CCGCGTCAACTTCCGCTATGAGGTGACAGGCGACCGTGCCCCGTGGCGACCGCTGCGCGCCTTTGATGAC
GGCAAGCAGATATTCATCGAGTTTCCGCGCGGGATCGGCCAGGGCGAGATGCCGCCTCTGTTTGTCGTCG
GCCCGGAAGGTGACACCTCTGAACTCGTGAACTACCGCGTGCGCGGCAACTACATGATCGTCGATAGGCT
CTTTGCCGCCGCCGAACTGCGTTTCGGAGCCGACAAGAATCAGAAGCGCGTCCGCATCTCCCGCACCGAC
GGGAGGCCCGCGTCGTGA
 Primer design