SecReT4
Protein ID: 294011979
T4SS name [ID]Trb [310]
Gene symboltrbL
Locus tagSJA_C1-19930
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]1990212..1991576 [-]
Producttype IV secretory pathway TrbL component
Component typeTrbL
UniProt IDD4Z2J5
KEGG IDsjp:SJA_C1-19930
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.3e-52, Aligned region: 37..262
Protein Sequence: 454 a.a.     [Download]
>gi|294011979|ref|YP_003545439.1| type IV secretory pathway TrbL component [Sphingobium japonicum UT26S]
MQGTGVIDHFLEVFTRYIDGGFGLLGDEVAFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYIIGNWNNLARIVFESFAGLGLKASGTGFSVADLLRPGKVAQTGLDAGRPLLDSISDLMGWVSFFENFI
QIACLLFAWALILLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNIISSGIKVLVL
AVIIGIGSTLFSEFTAGFGGATPTIDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLA
AGGMVMAGGAALGAAAGGVGALAGGAAAAARGGAALAGGASTAYSLGAAGESGASAVASGLGNVASTGAQ
AAVSPLKRAAGRAADSLKSSYQSGARAAFEVSGGSSTAGTIGGETAEAGAAPASAAPPDGPPSWARRMKR
SQQLSHGVSAAAHAVKSGDSHGGGSSINLSESDR
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c1991576-1990212 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGCAAGGCACTGGCGTCATCGACCATTTCCTTGAGGTCTTCACCCGCTATATCGACGGCGGCTTCGGAT
TGCTCGGCGATGAGGTCGCGTTCATCGCCACGACGCTGATCGTCATCGACGTGACGCTCGCCGCCCTGTT
CTGGTCATGGGGCGCCGATGACGACATCATTGCCCGGCTGGTCAAGAAGACGCTGTTCGTTGGCGTCTTC
GCCTACATCATCGGCAACTGGAACAATCTCGCCCGCATCGTCTTCGAGAGTTTCGCGGGGCTCGGCCTGA
AGGCGAGCGGCACCGGCTTCTCCGTCGCCGACCTGCTGCGCCCCGGCAAGGTGGCGCAAACCGGCCTCGA
CGCCGGCCGCCCGCTGCTTGATTCCATCTCCGACCTGATGGGCTGGGTCTCGTTCTTCGAGAATTTCATC
CAGATTGCCTGCCTGCTCTTCGCCTGGGCGCTGATCCTGCTCGCCTTCTTCATCCTCGCCGTCCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACAACACTCGCCGGCTTCGTCCTCATTCCCTTCGGCCTGTTCGG
CAAGAGCGCCTTCATGGCGGAGCGGGTGCTGGGCAACATCATCTCGTCCGGCATCAAGGTTCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACGCTCTTCTCCGAATTCACCGCAGGTTTTGGCGGCGCCACGCCGA
CGATCGACGACGCGATGGCGATCGTGCTGGCCGCGCTGTCGCTGCTCGGCCTTGGCATCTTCGGCCCCGG
CATCGCCAACGGACTCGTCTCTGGCGGCCCCCAGCTTGGGGCGGGAGCCGCGGTCGGAACCGGCCTGGCC
GCTGGCGGCATGGTGATGGCGGGCGGCGCTGCCCTTGGGGCTGCCGCGGGCGGTGTAGGCGCTCTCGCCG
GTGGCGCTGCCGCTGCCGCCCGTGGCGGGGCAGCGCTCGCCGGCGGTGCTTCGACGGCTTACAGCCTTGG
CGCCGCCGGAGAATCCGGTGCATCCGCCGTAGCGTCCGGCCTTGGCAATGTCGCCAGCACGGGGGCACAG
GCCGCCGTCTCGCCATTGAAGCGTGCCGCCGGCCGCGCGGCTGACAGCCTCAAGTCCAGCTATCAGTCGG
GCGCACGCGCTGCGTTCGAGGTGTCGGGCGGCTCGTCCACTGCCGGCACCATCGGCGGCGAAACCGCAGA
GGCCGGAGCGGCCCCCGCGTCCGCCGCGCCGCCTGACGGCCCGCCGTCCTGGGCCAGGCGCATGAAGCGT
TCGCAGCAGCTTTCACATGGCGTTTCCGCTGCCGCACACGCCGTCAAGTCAGGCGACAGCCATGGCGGCG
GCTCCTCGATCAACCTCTCCGAAAGTGACCGCTGA
 Primer design