SecReT4
Protein ID: 294011984
T4SS name [ID]Trb [310]
Gene symbolvirB2
Locus tagSJA_C1-19980
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]1995491..1995832 [-]
Producttype IV secretory pathway VirB2 component
Component typeTrbC
UniProt IDD4Z2K0
KEGG IDsjp:SJA_C1-19980
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-26, Aligned region: 10..103
Protein Sequence: 113 a.a.     [Download]
>gi|294011984|ref|YP_003545444.1| type IV secretory pathway VirB2 component [Sphingobium japonicum UT26S]
MMPAVQRLRLARRRLAMTVSIATLSVVMAAPAHASGSSMPWEQPLQQILQSIEGPVAKIIAVIIIITTGL
TLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 342 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c1995832-1995491 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGATGCCTGCCGTTCAACGCCTGCGCCTTGCGCGCCGCCGTCTCGCCATGACCGTTTCCATCGCCACGC
TTTCCGTTGTGATGGCCGCGCCCGCCCATGCCTCCGGCTCATCGATGCCGTGGGAACAACCGCTCCAGCA
AATCCTCCAGTCGATCGAAGGCCCGGTCGCCAAGATCATCGCCGTCATCATCATTATCACGACCGGCCTG
ACGCTGGCCTTTGGCGACACATCGGGCGGCTTCCGCCGCCTGATTCAGATCGTGTTCGGCCTGTCGATCG
CTTTCGCCGCGTCGAGCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGTGGGGCGCTGGTCTGA
 Primer design