SecReT4
Protein ID: 294012949
T4SS name [ID]Trb [311]
Gene symboltrbG
Locus tagSJA_C1-29630
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]2953090..2953947 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD4Z5B5
KEGG IDsjp:SJA_C1-29630
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-65, Aligned region: 56..276
Protein Sequence: 285 a.a.     [Download]
>gi|294012949|ref|YP_003546409.1| conjugal transfer protein TrbG [Sphingobium japonicum UT26S]
MIHKSTISFAMLAMIASPAIADGRNRSAQAQNRGLANVELANRHATLGPKTDAFLNAVQIYPYSAGTIYK
LITAPERITDIALEQGEMLVSVASGDTVRWVIGDTSSGNGATKRTHILVKPSLTGLSTNLLIMTDRRAYH
LALVSTGRTALTGISWSYPEDALLALRRANDAARAAEPIAAGIQVEQLHFNYAISGDTPTWRPLRAFDDG
RQTYIEFPASIVVGDAPPLFLVDGKGEAQLVNYRLRDRFYIVDRIFDQAELRFGTRKQQVVRITRTGASR
RRRAS
 
Nucleotide Sequence: 858 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c2953947-2953090 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGATCCATAAATCAACCATTTCGTTCGCCATGCTGGCTATGATCGCATCGCCCGCCATCGCTGATGGGA
GAAACAGGTCGGCGCAGGCGCAGAATCGCGGCCTGGCAAATGTCGAACTCGCCAATCGCCATGCCACCTT
GGGCCCCAAAACAGATGCATTCCTGAATGCGGTACAGATTTACCCTTATTCGGCGGGGACGATCTACAAG
CTGATCACCGCGCCCGAACGTATAACGGACATCGCGCTGGAGCAGGGGGAAATGCTCGTCTCCGTCGCGA
GCGGGGATACGGTTCGCTGGGTCATAGGCGATACGTCCAGCGGCAACGGAGCGACCAAGCGGACTCATAT
ATTGGTCAAGCCCAGCCTGACGGGCCTGTCGACCAATCTTCTGATTATGACCGATCGCCGTGCCTATCAT
CTCGCGCTGGTCAGCACCGGACGCACCGCGCTTACCGGGATTTCGTGGAGCTATCCTGAAGATGCCCTGC
TGGCGCTGCGCCGCGCGAATGACGCTGCCCGTGCCGCTGAACCCATCGCCGCAGGCATTCAGGTCGAGCA
GCTGCATTTCAATTATGCAATTTCGGGCGATACGCCGACGTGGCGTCCGCTCCGCGCTTTTGATGACGGT
CGCCAGACCTATATCGAATTTCCAGCGTCGATCGTTGTTGGCGATGCGCCGCCACTCTTTCTGGTCGACG
GCAAGGGGGAGGCGCAGCTCGTCAATTATCGGCTCAGGGACCGCTTCTACATCGTCGACCGGATCTTCGA
TCAGGCTGAACTCCGCTTTGGCACCAGAAAGCAGCAGGTTGTGAGGATCACACGGACTGGCGCATCTCGC
CGACGGAGGGCGTCATGA
 Primer design