SecReT4
Protein ID: 294012951
T4SS name [ID]Trb [311]
Gene symboltrbL
Locus tagSJA_C1-29650
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]2954722..2956017 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDD4Z5B7
KEGG IDsjp:SJA_C1-29650
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-49, Aligned region: 37..262
Protein Sequence: 431 a.a.     [Download]
>gi|294012951|ref|YP_003546411.1| conjugal transfer protein TrbL [Sphingobium japonicum UT26S]
MNDLNVIDQFLAAFIAYIDSGFGLLGGDVRFLTATLIGIDMTLAGLFWAMGGEHDVIGRFLKKILFVGAF
AFIINSFSSLSEIIFRSFAAAGLTAGGGSIPAEDLLKPGRLAGAGFEAAWPLLDQASDLMGFTSFFDNFL
TIAILLFAWVIVILAFFILAVQMFVTVIEFKLVSLAGFILIPFALWNRTSFLAERVLGHVVSSGIKVMVL
GVIVGIGSSFFSQMVDALKGQEPDIGAAMSLVLAALALFGLGIFAPAMASGLAAGAPQLGAGAAVGSAAG
AAGVAVLGGAAAIGGGRALAGGALSAIRVGTMMGTAAQAAYKLGQETSGSSGMATGLSGVATAAGHAVRN
KAASSLGIADAAERGREVAWSALGTGGAKSAGAKQGDVPDWAQAMQRRQDGRHHRHLAAQTLKEGDRGGA
AVTPDIHEKDD
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c2956017-2954722 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGAATGATCTCAATGTCATCGACCAATTTCTCGCGGCCTTCATCGCCTATATCGACAGCGGCTTCGGCC
TGCTGGGCGGCGATGTGCGGTTCTTGACGGCCACGCTGATTGGCATCGACATGACCCTCGCAGGGCTTTT
CTGGGCGATGGGCGGCGAGCATGATGTGATCGGGCGGTTCCTGAAGAAAATCCTCTTCGTTGGCGCCTTT
GCCTTCATCATCAACAGCTTCTCCTCTCTTTCCGAAATCATCTTCCGTTCCTTTGCCGCGGCCGGGCTGA
CGGCGGGTGGGGGCAGCATCCCGGCGGAGGATCTGCTGAAGCCCGGAAGGTTGGCCGGAGCCGGTTTCGA
GGCGGCGTGGCCGCTGCTCGACCAGGCGTCCGATCTGATGGGGTTCACCAGCTTCTTCGACAATTTCCTG
ACGATCGCCATATTGCTGTTCGCCTGGGTGATCGTCATTCTCGCCTTCTTCATCCTTGCCGTGCAGATGT
TCGTCACCGTGATCGAGTTCAAGCTCGTGTCGCTGGCGGGTTTCATTCTCATTCCCTTCGCGCTCTGGAA
CCGCACGAGCTTCCTCGCTGAACGCGTGCTGGGTCATGTCGTGAGTTCCGGAATCAAAGTCATGGTGCTG
GGCGTGATTGTCGGGATCGGCTCCAGCTTCTTTTCGCAGATGGTAGATGCCCTCAAGGGGCAGGAACCCG
ACATCGGCGCCGCCATGAGCCTGGTGCTGGCGGCTCTGGCCCTGTTCGGCCTTGGCATCTTTGCGCCTGC
CATGGCGTCGGGCCTTGCCGCCGGAGCGCCGCAATTGGGAGCGGGCGCCGCCGTTGGCAGCGCGGCTGGT
GCCGCCGGGGTCGCGGTTCTAGGCGGTGCCGCCGCGATCGGTGGCGGCCGAGCGCTTGCCGGTGGCGCAC
TATCCGCGATCCGGGTCGGCACCATGATGGGGACGGCGGCGCAGGCAGCCTACAAGCTAGGCCAGGAGAC
TTCCGGCTCGTCGGGCATGGCCACCGGACTGAGTGGTGTCGCCACGGCAGCCGGACATGCCGTCCGCAAC
AAGGCTGCAAGCAGCCTGGGTATCGCCGACGCCGCCGAGCGTGGACGGGAGGTGGCCTGGTCGGCGCTGG
GCACGGGCGGTGCAAAATCAGCCGGAGCAAAGCAGGGCGATGTACCGGACTGGGCGCAGGCGATGCAACG
CCGGCAGGATGGGCGCCATCACCGTCACCTTGCCGCGCAGACATTGAAGGAAGGCGATCGCGGCGGCGCG
GCCGTTACCCCCGACATTCACGAAAAGGACGACTGA
 Primer design