SecReT4
Protein ID: 294012955
T4SS name [ID]Trb [311]
Gene symboltrbC
Locus tagSJA_C1-29690
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]2959595..2959882 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDD4Z5C1
KEGG IDsjp:SJA_C1-29690
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-22, Aligned region: 1..84
Protein Sequence: 95 a.a.     [Download]
>gi|294012955|ref|YP_003546415.1| conjugal transfer protein TrbC [Sphingobium japonicum UT26S]
MLAAGLAMASAAAHAAGSGMPWEQPLEQVLESVQGPVAKIVAVIIIITTGLTLAFGETSGGFRRLIQIVF
GLSIAFAASSFFLSFFSFGGGALVA
 
Nucleotide Sequence: 288 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c2959882-2959595 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGCTCGCCGCTGGCCTTGCCATGGCTTCGGCCGCCGCGCATGCCGCCGGCTCCGGCATGCCCTGGGAAC
AGCCGCTCGAACAGGTGCTGGAATCGGTGCAGGGACCGGTGGCGAAGATCGTCGCCGTGATCATCATCAT
CACGACCGGCCTCACGCTTGCCTTTGGTGAGACCTCGGGTGGATTTCGCCGCCTGATCCAGATCGTCTTC
GGCCTTTCCATCGCTTTTGCCGCATCGTCCTTCTTCCTTTCCTTTTTCAGCTTCGGCGGCGGGGCGCTCG
TGGCATGA
 Primer design