SecReT4
Protein ID: 294023759
T4SS name [ID]Tra_F [808]
Gene symbol-
Locus tagSJA_P1-01030
StrainSphingobium japonicum UT26S
Repliconplasmid pCHQ1 [GenBank: NC_014007] [Browse all T4SS(s) in this replicon]
Location [Strand]79698..79964 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDD4Z8X3
KEGG IDsjp:SJA_P1-01030
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 8e-05, Aligned region: 4..59
Protein Sequence: 88 a.a.     [Download]
>gi|294023759|ref|YP_003547078.1| hypothetical protein SJA_P1-01030 [Sphingobium japonicum UT26S]
MDERLPQYLHRPVQILWFGSDEFILVMSTIFVAVIVGGVIGWTLIGALLLFIPWKRTKPRGFIPHLAWRW
GLLRFRHYPGPTQTRFFE
 
Nucleotide Sequence: 267 bp     [Download]
>gi|294023656|ref|NC_014007.1|:79698-79964 Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence
TTGGACGAACGTCTGCCCCAGTATCTCCATCGGCCGGTGCAGATCCTCTGGTTCGGCTCGGACGAGTTCA
TATTGGTCATGTCGACCATCTTCGTCGCCGTCATCGTCGGCGGAGTGATCGGCTGGACGCTGATCGGCGC
TCTTCTCCTTTTCATTCCCTGGAAGCGCACCAAGCCGCGCGGGTTCATCCCGCATCTCGCCTGGCGTTGG
GGCCTGCTGCGCTTCCGTCACTATCCGGGTCCGACACAGACCCGCTTCTTCGAGTGA
 Primer design