SecReT4
Protein ID: 294023774
T4SS name [ID]Tra_F [808]
Gene symbol-
Locus tagSJA_P1-01180
StrainSphingobium japonicum UT26S
Repliconplasmid pCHQ1 [GenBank: NC_014007] [Browse all T4SS(s) in this replicon]
Location [Strand]92864..93763 [+]
Productthioredoxin-related protein
Component typeTraF_F
UniProt IDD4Z8Y8
KEGG IDsjp:SJA_P1-01180
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.7e-36, Aligned region: 31..235
Thioredoxin [PF00085], Evalue: 1e-07, Aligned region: 154..221
Protein Sequence: 299 a.a.     [Download]
>gi|294023774|ref|YP_003547093.1| thioredoxin-related protein [Sphingobium japonicum UT26S]
MKGSAIVLAAALGLAPLSASAQAQSDPAREGYWWYAPKPEPAEPKPAEEDALVKPAIPPMAELATWTPPK
IRKLIEQQRDYAATVLTVDAVADFWRLQDFARRKARAFAGVTQLAMLQHPELNSKSANPMVGDARDQLLA
YKDDTRRQYLRAHAGEFALVMFSRTTCGYCRVQWPIVQRFQDEMGWQVTLMDIDRRPELGARFGVEVTPT
TMIIRRNSQQRMIIASGVEAYPNLAQMAYQAVRLLTGDIRPEQFMTGAGEEGGFFDALGLGPVSASDPRA
AEEMVGGNLISSPPDQKPR
 
Nucleotide Sequence: 900 bp     [Download]
>gi|294023656|ref|NC_014007.1|:92864-93763 Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence
GTGAAGGGGAGCGCGATCGTCCTCGCCGCTGCGCTCGGACTTGCGCCGCTGTCGGCTTCCGCGCAGGCGC
AGTCAGACCCCGCGCGTGAGGGCTATTGGTGGTATGCACCGAAGCCTGAGCCGGCCGAACCCAAGCCGGC
CGAGGAAGATGCGTTGGTCAAGCCGGCGATCCCGCCGATGGCAGAGCTTGCGACATGGACACCCCCTAAG
ATTCGCAAGCTCATTGAACAGCAGCGCGACTATGCTGCAACCGTGCTCACGGTCGATGCAGTCGCCGACT
TCTGGCGGCTCCAGGATTTTGCACGGCGAAAAGCCAGGGCGTTCGCCGGCGTCACGCAACTCGCGATGCT
GCAGCATCCCGAGCTCAACTCGAAGTCCGCCAATCCGATGGTCGGCGATGCACGCGATCAACTGCTTGCC
TACAAGGACGACACGCGCCGCCAATATCTGCGGGCGCACGCCGGTGAGTTCGCGCTGGTCATGTTCAGCC
GCACCACCTGCGGTTACTGCCGTGTCCAGTGGCCGATCGTCCAACGCTTCCAGGACGAGATGGGTTGGCA
GGTGACGCTCATGGACATCGATCGCCGCCCGGAGCTCGGGGCCCGCTTTGGGGTCGAGGTGACCCCGACC
ACGATGATCATTCGTCGGAACAGCCAGCAGCGCATGATCATCGCAAGCGGCGTAGAAGCCTATCCGAATC
TCGCGCAGATGGCCTATCAGGCAGTGCGCCTTCTGACCGGCGATATTCGGCCCGAGCAGTTCATGACCGG
AGCCGGCGAGGAAGGTGGTTTCTTTGACGCTCTGGGCCTGGGGCCTGTCTCAGCAAGCGATCCACGAGCC
GCAGAAGAGATGGTCGGTGGCAATCTCATCAGCTCGCCGCCGGACCAGAAGCCACGATGA
 Primer design