SecReT4
Protein ID: 294023826
T4SS name [ID]Trb [293]
Gene symboltrbG
Locus tagSJA_P1-01700
StrainSphingobium japonicum UT26S
Repliconplasmid pCHQ1 [GenBank: NC_014007] [Browse all T4SS(s) in this replicon]
Location [Strand]139199..140248 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD4Z940
KEGG IDsjp:SJA_P1-01700
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.5e-70, Aligned region: 118..342
Protein Sequence: 349 a.a.     [Download]
>gi|294023826|ref|YP_003547145.1| conjugal transfer protein TrbG [Sphingobium japonicum UT26S]
MRPSFRKAGMPASRIQACAHPRIGTLPVILLATTALAGCATTHKPPEISYDNAAPAVQTVDPPAPVTVVE
LPRPLPLPGQMKPVERSRQAPEPADPAARVNQANAAARVQPVRDGFINSMQVYPFTQGALYQVYTAVGQI
TDIALQPGEQLVGSGPVAAGDTVRWIIGDTLSGSGATQQVHILVKPTRPELMTNLIINTTLRTYHMELRS
TERTYMASVSWQYPQDQLIALRRQNAQAEATRPVATGVDLTNVNFRYAIEGDRAPWRPLRAFDDGRQVFI
EFPRGIGQGEMPPLFVVGAEGNTSELVNYRVRSNYMIVDRLFAAAELRFGAGREQKRVRIVRTDGRPTS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|294023656|ref|NC_014007.1|:c140248-139199 Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence
ATGAGGCCGTCGTTCCGTAAAGCCGGAATGCCGGCTTCACGCATCCAAGCATGTGCGCATCCACGGATCG
GCACGCTGCCGGTCATTCTGCTCGCCACGACGGCGCTCGCTGGATGCGCGACCACGCACAAGCCGCCGGA
GATCTCCTACGACAATGCCGCCCCCGCCGTGCAGACGGTCGATCCGCCGGCGCCCGTCACCGTCGTGGAG
CTACCCCGGCCGCTTCCGCTTCCCGGCCAGATGAAGCCGGTCGAGCGCTCCCGGCAAGCGCCGGAACCCG
CCGATCCGGCTGCACGGGTGAACCAGGCCAATGCCGCGGCGCGCGTGCAGCCCGTGCGCGACGGCTTCAT
CAATTCGATGCAGGTCTATCCGTTCACCCAGGGCGCGCTCTATCAGGTGTATACCGCGGTCGGGCAGATC
ACCGATATCGCGCTTCAGCCCGGTGAGCAGCTCGTCGGGTCCGGCCCGGTCGCCGCCGGAGACACCGTCC
GCTGGATTATCGGCGACACGCTAAGCGGCTCGGGCGCGACGCAACAGGTCCATATCCTGGTCAAGCCGAC
GCGGCCGGAGCTGATGACGAACCTCATCATCAACACCACTCTGCGAACCTACCACATGGAGCTACGCTCG
ACCGAGCGCACCTACATGGCGTCGGTTTCCTGGCAATATCCCCAAGACCAGCTCATAGCGCTGCGTCGCC
AGAATGCGCAGGCCGAGGCGACCCGTCCCGTCGCCACCGGCGTCGATCTGACCAACGTCAATTTCCGCTA
CGCGATCGAAGGCGATCGCGCGCCATGGCGGCCGCTTCGGGCCTTTGATGACGGACGGCAGGTGTTCATC
GAATTCCCGCGCGGCATTGGCCAGGGTGAGATGCCGCCGCTGTTCGTCGTCGGTGCCGAAGGCAACACGT
CCGAACTCGTCAACTACCGGGTCCGCTCGAACTACATGATCGTCGACCGCCTCTTCGCCGCCGCCGAGCT
GCGCTTCGGTGCCGGCCGCGAGCAGAAGCGCGTCCGCATCGTCCGGACCGACGGGAGGCCGACCTCGTGA
 Primer design