SecReT4
Protein ID: 294023828
T4SS name [ID]Trb [293]
Gene symboltrbL
Locus tagSJA_P1-01720
StrainSphingobium japonicum UT26S
Repliconplasmid pCHQ1 [GenBank: NC_014007] [Browse all T4SS(s) in this replicon]
Location [Strand]140928..142286 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDD4Z942
KEGG IDsjp:SJA_P1-01720
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.5e-53, Aligned region: 37..262
Protein Sequence: 452 a.a.     [Download]
>gi|294023828|ref|YP_003547147.1| conjugal transfer protein TrbL [Sphingobium japonicum UT26S]
MGNTGVIDHFLEVFTRYIDGGFGLLGGEVTFIATTLIVIDVTLAALFWSWGADDDIIARLVKKTLFVGVF
AYIIGNWNNLARIIFESFAGLGLKASGTSFTTADLLRPGKVAQTGLDAGRPLLDSISGLMGYWSFFENFI
QIACMFLAWALVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNLISSGIKVLVL
AVIIGIGSTLFSEFTAGFGGATPSVDEAMAIVLAALSLLGLGIFGPGIASGIVSGGPQLSAGAAVGTGLA
AGGMVALGAGAVGAAATGGASLAGGAAAAARGGAALAGGASTAYSLGAAGQTGAASVAAGLGGVARAGGS
AAISPLRRAASRAAEGMRSSFNAGGRAVLGATGGSTTGGPSAGGPGSEDAAATAGGGGPPAWAQRMRRRQ
QMSHAVQATAHAVRSGDAHGGGSSVNLSEGDR
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|294023656|ref|NC_014007.1|:c142286-140928 Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence
ATGGGGAACACCGGCGTCATCGACCATTTCCTCGAGGTCTTCACCCGTTACATCGACGGCGGCTTCGGTC
TGCTCGGCGGCGAGGTGACGTTCATCGCCACGACGCTGATTGTGATCGACGTGACGCTCGCGGCGCTCTT
CTGGTCCTGGGGCGCCGATGACGACATCATCGCCCGACTGGTGAAGAAGACGCTGTTCGTCGGCGTTTTC
GCCTACATCATCGGCAACTGGAACAACCTCGCCCGGATCATCTTCGAGAGCTTCGCCGGTCTCGGCCTGA
AGGCGAGCGGCACCAGCTTCACCACGGCCGATCTTCTTCGCCCCGGCAAGGTCGCGCAGACCGGGCTCGA
TGCGGGACGGCCGCTGCTCGATTCGATCTCCGGGCTGATGGGCTATTGGAGCTTCTTCGAGAACTTCATC
CAGATCGCCTGCATGTTCCTCGCCTGGGCGCTGGTGCTGCTCGCCTTCTTCATCCTCGCCATCCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACGACGCTCGCCGGCTTCGTGCTGATCCCCTTCGGCCTGTTCGG
AAAGTCCGCCTTCATGGCCGAACGGGTGCTCGGCAACCTCATCTCGTCCGGCATCAAGGTCCTCGTCCTC
GCGGTCATCATCGGGATCGGATCGACCCTGTTCTCCGAATTCACGGCGGGCTTCGGGGGCGCCACGCCAT
CGGTCGACGAGGCGATGGCCATCGTCCTCGCAGCCCTCTCATTGCTCGGCCTTGGCATCTTCGGGCCCGG
CATCGCGTCCGGCATCGTCTCGGGCGGTCCGCAGCTCAGCGCCGGCGCTGCCGTCGGCACGGGTCTCGCC
GCCGGCGGCATGGTCGCGCTCGGAGCCGGCGCCGTGGGCGCCGCCGCGACAGGCGGCGCCTCCCTGGCAG
GCGGGGCCGCCGCCGCCGCCCGCGGTGGCGCTGCCCTCGCTGGCGGCGCATCGACCGCCTACAGCCTCGG
GGCCGCGGGGCAGACGGGCGCTGCTAGCGTCGCCGCCGGTCTGGGCGGCGTCGCCCGGGCCGGCGGGAGT
GCCGCGATCTCGCCCCTTCGTCGCGCCGCCTCCCGCGCCGCTGAAGGCATGCGCTCGAGCTTCAATGCCG
GCGGCCGCGCGGTTCTTGGAGCCACGGGCGGCTCCACGACCGGTGGACCGAGCGCCGGCGGACCGGGGTC
CGAAGATGCGGCTGCTACGGCAGGCGGCGGAGGCCCACCCGCCTGGGCGCAGCGCATGCGCCGCCGCCAG
CAAATGTCCCATGCCGTCCAGGCGACGGCCCATGCCGTCCGCTCGGGTGATGCCCATGGCGGCGGCTCCT
CCGTCAACCTGTCCGAAGGCGACCGCTGA
 Primer design