SecReT4
Protein ID: 294023833
T4SS name [ID]Trb [293]
Gene symboltrbC
Locus tagSJA_P1-01770
StrainSphingobium japonicum UT26S
Repliconplasmid pCHQ1 [GenBank: NC_014007] [Browse all T4SS(s) in this replicon]
Location [Strand]146126..146458 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDD4Z947
KEGG IDsjp:SJA_P1-01770
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.6e-24, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|294023833|ref|YP_003547152.1| conjugal transfer protein TrbC [Sphingobium japonicum UT26S]
MIQHALRIRRHIATAVSVTFLSLALAPAAHASGSSMPWEAPLQSILESIEGPVAKIVAVIIIIITGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|294023656|ref|NC_014007.1|:c146458-146126 Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence
GTGATCCAGCACGCGCTTCGAATCCGCCGCCATATCGCGACGGCCGTTTCCGTCACCTTTCTCAGTCTGG
CGCTCGCACCGGCGGCCCACGCCTCCGGCTCCTCGATGCCGTGGGAAGCGCCGCTTCAGTCGATCCTCGA
GTCGATCGAGGGGCCGGTCGCCAAGATCGTCGCCGTGATCATCATCATCATCACCGGCCTGACCCTGGCC
TTCGGCGACACGTCCGGCGGCTTCCGGCGGCTCATCCAGATCGTTTTCGGCCTGTCGATCGCGTTCGCGG
CGTCGAGCTTCTTCCTGTCCTTCTTCTCGTTCGGCGGCGGAGCGCTCGTCTGA
 Primer design