SecReT4
Protein ID: 294496767
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p083
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]77908..78393 [-]
Productputative lytic transglycosylase
Component typeOrf169_F
UniProt IDD4HQJ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 161 a.a.     [Download]
>gi|294496767|ref|YP_003560460.1| putative lytic transglycosylase [Klebsiella pneumoniae]
MKGVAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQESRFKIDAIGRNPVTGYGSGLMQIDSQ
HFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAFKKWGVSWDAVGAYNAGFKKTPRQAARRYEYAKKIHY
YYTAIKASKRTSSKDQKIAMN
 
Nucleotide Sequence: 486 bp     [Download]
>gi|294496685|ref|NC_014016.1|:c78393-77908 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAAGGGAGTAGCGTTTGGTATCATCCTGTCTTTAATACCATTGTCATCAATGGCAGCAGACTGCTTTG
ATATGGCTGGCAGGGATTACAAAATTGATCCGGATCTCCTGCGTGCTATATCATGGCAAGAATCACGATT
TAAAATTGATGCGATTGGGCGTAATCCTGTTACGGGTTATGGATCAGGCTTGATGCAAATTGACTCGCAG
CATTTCAACGAACTGTCGCGATATGGAATAAAACCGGATCATCTTCTTAGCGATGCTTGTCTTAACATCT
ACACCGGAGCCTATTATCTGGCTCAGGCGTTTAAAAAGTGGGGCGTTTCGTGGGATGCAGTCGGGGCATA
CAATGCAGGCTTCAAAAAGACCCCGCGCCAGGCAGCAAGACGTTACGAGTATGCGAAGAAGATCCATTAC
TACTACACGGCTATCAAAGCAAGCAAACGAACTTCTTCTAAAGATCAGAAAATCGCCATGAACTAA
 Primer design