SecReT4
Protein ID: 294496768
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p084
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]78815..79213 [+]
Productmating signal protein
Component typeTraM_F
UniProt IDD5KTQ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 6.1e-61, Aligned region: 1..126
Protein Sequence: 132 a.a.     [Download]
>gi|294496768|ref|YP_003560461.1| mating signal protein [Klebsiella pneumoniae]
MPRVQVYISDQVVEKINAIIEQRRAGGAKDKDVNFSSISSMLIELGLRVYEAQMERKESGFNQMAFNKAL
FEYVVKTQFSMNKVLGIECLSPHVKDDPRWQWKGIIQNIQEDVQEVMRMYFPEEDEVNNTND
 
Nucleotide Sequence: 399 bp     [Download]
>gi|294496685|ref|NC_014016.1|:78815-79213 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGCCAAGAGTGCAGGTTTATATAAGTGATCAGGTTGTTGAGAAAATCAATGCAATCATTGAGCAGCGTC
GTGCTGGCGGTGCTAAGGACAAGGATGTGAATTTTTCAAGTATCAGTTCGATGCTCATTGAGCTTGGGCT
TCGTGTGTATGAAGCTCAAATGGAACGTAAGGAGTCTGGTTTCAATCAGATGGCATTCAATAAGGCTTTA
TTCGAATATGTAGTTAAAACACAGTTTTCTATGAATAAAGTTTTGGGTATTGAATGCCTCAGTCCCCATG
TAAAGGATGACCCTCGATGGCAATGGAAAGGGATCATTCAGAATATTCAGGAAGACGTGCAGGAAGTTAT
GCGTATGTATTTCCCTGAAGAGGATGAGGTAAATAATACTAATGATTAA
 Primer design