SecReT4
Protein ID: 294496770
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p086
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]80152..80538 [+]
ProductoriT nicking
Component typeTraY_F
UniProt IDD5KTQ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 3.5e-37, Aligned region: 14..60
TraY [PF05509], Evalue: 3.5e-37, Aligned region: 73..119
Protein Sequence: 128 a.a.     [Download]
>gi|294496770|ref|YP_003560463.1| oriT nicking [Klebsiella pneumoniae]
MKRLVNRPAAGSAVVFTCDDETYQHLTLAIRRSGRVKGTEVQLRVDDHLRKFPDFYDVQKIYCAEEKREK
RLFLRFDEQTNKMLIKAKNRSGRSKSLEVYLRLKAHLLEFPDFYSSEVEVIRRSESET
 
Nucleotide Sequence: 387 bp     [Download]
>gi|294496685|ref|NC_014016.1|:80152-80538 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
GTGAAACGACTTGTTAATCGTCCTGCTGCAGGTAGTGCAGTTGTTTTTACCTGTGACGATGAAACTTATC
AGCATCTGACATTAGCAATACGCAGGAGTGGTCGAGTTAAAGGCACGGAAGTTCAACTGCGTGTTGATGA
TCATCTAAGGAAGTTTCCTGATTTTTACGATGTTCAGAAAATTTACTGTGCTGAAGAAAAACGAGAAAAA
CGGTTATTTCTTCGGTTTGATGAACAAACTAACAAAATGTTAATTAAGGCAAAAAACAGAAGTGGACGCT
CGAAATCGCTCGAAGTTTACCTTCGCCTTAAAGCGCATCTGTTGGAATTTCCTGATTTTTATAGCTCTGA
AGTCGAAGTGATAAGGAGGTCTGAATCTGAAACATAA
 Primer design