SecReT4
Protein ID: 294496771
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p087
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]80592..80960 [+]
ProductF pilin subunit
Component typeTraA_F
UniProt IDD5KTQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 7.8e-35, Aligned region: 1..120
Protein Sequence: 122 a.a.     [Download]
>gi|294496771|ref|YP_003560464.1| F pilin subunit [Klebsiella pneumoniae]
MNAVLSVQGSAVPEKTKPSFLSRVFNKKKALKVAKVALPVAAVAAFFPDAAMATTTATDLMKSGDATVKG
TFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKFLFGFAIISTFITIGMSVAGY
 
Nucleotide Sequence: 369 bp     [Download]
>gi|294496685|ref|NC_014016.1|:80592-80960 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAATGCTGTATTAAGTGTTCAGGGCTCTGCTGTCCCTGAAAAAACCAAACCGTCTTTTCTGTCTCGCG
TTTTCAATAAAAAGAAAGCCCTGAAAGTCGCTAAAGTTGCGCTGCCGGTTGCTGCTGTGGCGGCGTTCTT
CCCGGATGCTGCGATGGCCACCACCACGGCAACCGACCTGATGAAGTCCGGGGATGCGACCGTTAAAGGC
ACGTTTGGTAAGCAGTCCAGTGTCGTCAAATGGGTGGTTCTGGCAGAAGTTGTCGCCGGCGGCATCATGT
ACATGATGACCAAAAACGTGAAGTTCCTGTTTGGCTTCGCGATTATTTCCACCTTTATCACCATCGGTAT
GTCGGTCGCCGGTTACTGA
 Primer design