SecReT4
Protein ID: 294496772
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p088
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]80974..81279 [+]
ProductF pilus assembly protein
Component typeTraL_F
UniProt IDD5KTR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-38, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|294496772|ref|YP_003560465.1| F pilus assembly protein [Klebsiella pneumoniae]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGIASAVLVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|294496685|ref|NC_014016.1|:80974-81279 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATTTT
TGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design