SecReT4
Protein ID: 294496773
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p089
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]81299..81865 [+]
ProductF pilus assembly protein
Component typeTraE_F
UniProt IDD4HQK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.6e-75, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|294496773|ref|YP_003560466.1| F pilus assembly protein [Klebsiella pneumoniae]
MEHGARQNTTRVIAVGFISLGTLLTLSLATNIIQGINNYRLQTEQKVAVTPMLFRAPFAVSQNQADASYI
EQLGLSFVALRLNVTPETVDAQHQQLLRYVLPASQNSLKVQLAEDAKRIKDNNVNSTFYMTSMRAWPAEN
RVDIRGELKTWIGDSKPYSEIKSYVIQFSRVDGVSWLARFGEINNEKN
 
Nucleotide Sequence: 567 bp     [Download]
>gi|294496685|ref|NC_014016.1|:81299-81865 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGGAACATGGTGCCAGACAAAATACCACCCGCGTTATCGCTGTGGGATTTATCAGTCTGGGGACACTCC
TGACCCTCAGTCTTGCGACCAATATTATCCAGGGCATAAATAATTACCGTCTGCAGACGGAACAGAAAGT
GGCGGTGACACCGATGTTATTCCGTGCACCCTTTGCGGTGTCTCAGAACCAGGCTGACGCCTCTTATATT
GAGCAGCTGGGCCTGTCCTTCGTTGCCCTGCGTCTGAATGTCACGCCGGAAACGGTTGATGCCCAGCATC
AGCAGCTACTCCGGTATGTATTACCCGCCTCGCAGAACAGCCTCAAGGTCCAGCTGGCTGAAGATGCGAA
ACGCATTAAAGACAATAACGTTAATTCCACCTTTTATATGACGTCGATGCGTGCCTGGCCGGCAGAGAAC
CGCGTGGATATCCGGGGTGAGCTGAAAACGTGGATTGGGGATTCCAAACCCTACAGTGAAATTAAAAGCT
ATGTCATTCAGTTCAGTCGTGTCGATGGTGTCAGCTGGCTGGCGCGTTTTGGAGAAATAAATAATGAAAA
AAATTAA
 Primer design