SecReT4
Protein ID: 294496774
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p090
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]81852..82592 [+]
ProductF pilus assembly protein
Component typeTraK_F
UniProt IDD5KTR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.2e-72, Aligned region: 11..237
Protein Sequence: 246 a.a.     [Download]
>gi|294496774|ref|YP_003560467.1| F pilus assembly protein [Klebsiella pneumoniae]
MKKINPLFISGCLLLVAPAMSATLSGTLAPTVVPLTNGGQANIAVSNTDPNLFTVPGDRITAINSLDGGL
TNQEQTDSGGAILATVSKKPFTFIVETERGLNFSIRAVPRAGSGRTIQLVSELAGTPGPAKAWEESNPYE
SLLVSLNRAVRQGSVPDEYQSVPVTSEVLQVPAGLRATADRVWVGHHLKVVRYSLDNVSLSARMVRESDF
WQPGTRAVMFSTPAGLLTAGGRMQIWVTTSDEGVKR
 
Nucleotide Sequence: 741 bp     [Download]
>gi|294496685|ref|NC_014016.1|:81852-82592 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAAAAAAATTAACCCGTTATTTATTTCAGGCTGTCTGCTGTTGGTCGCCCCCGCGATGTCCGCGACCC
TCAGCGGTACGCTGGCGCCGACAGTGGTCCCCCTCACCAATGGTGGTCAGGCAAATATTGCCGTGAGTAA
CACCGACCCGAATCTGTTCACAGTACCTGGAGATCGCATCACGGCGATAAACAGCCTGGACGGTGGCCTG
ACAAACCAGGAGCAGACCGACAGCGGCGGTGCCATTCTGGCGACCGTCAGTAAAAAACCATTCACCTTCA
TTGTGGAAACCGAACGCGGGCTGAACTTCTCCATTCGTGCCGTGCCCCGTGCGGGCTCAGGCCGGACAAT
TCAGCTGGTCAGCGAGCTGGCGGGTACCCCCGGTCCGGCAAAAGCCTGGGAAGAGTCGAACCCCTATGAA
TCGTTACTGGTTTCGCTGAATCGCGCCGTGCGTCAGGGCAGCGTACCCGATGAGTATCAGTCTGTCCCCG
TCACTTCTGAAGTGCTGCAGGTGCCGGCTGGTCTGCGCGCCACTGCCGACAGGGTCTGGGTCGGCCACCA
CCTGAAAGTCGTCCGTTACAGTCTGGACAATGTCTCCCTGTCGGCCCGTATGGTGCGTGAAAGCGATTTC
TGGCAGCCCGGAACACGTGCCGTCATGTTCAGTACCCCGGCGGGCCTGCTGACTGCCGGTGGTCGCATGC
AGATCTGGGTCACGACGTCAGATGAAGGAGTGAAGCGCTGA
 Primer design