SecReT4
Protein ID: 294496775
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p091
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]82592..84016 [+]
ProductF pilus assembly protein
Component typeTraB_F
UniProt IDD5KTR3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.6e-38, Aligned region: 209..405
Protein Sequence: 474 a.a.     [Download]
>gi|294496775|ref|YP_003560468.1| F pilus assembly protein [Klebsiella pneumoniae]
MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEAPAQGEPAPDMTGVVDSSFNSKVEQHA
TTEMQATAADLNKRFDSLQGEVDLLSKARTADQIRIDKLSSDNEAMQNQLKALGVKPAVSGGEPAPTPPS
PPPGPEGEPQPASYPPQTGAAVPPPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKTKSLPYI
PSGSFAKSMLIEGADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTR
NISCIKGDKTIDQPINGHISFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAS
VGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTIEELEAEKNGQQQ
AQNQEAGPAPQADAHHQSGGGMNGFNTDEMLKKLGKLDPREFSPGAAPQGENNG
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|294496685|ref|NC_014016.1|:82592-84016 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGGCCAACTTCAACACGCTGATCAAACGTAAGCAATATATCTGGCTGGGACTCATTCTGGCGGGCGGCG
CGGCAGCAGTCGGAGGCGGGCTGTATCTGTCAGATCTGAACATGAGCTCTGATGAGGAAGCCCCGGCTCA
GGGCGAACCCGCACCGGATATGACCGGGGTGGTCGACAGCAGCTTCAACAGTAAGGTGGAGCAGCACGCG
ACAACAGAAATGCAGGCGACTGCCGCTGATCTCAACAAGCGTTTTGACTCCCTGCAGGGGGAAGTGGACC
TGCTGAGTAAGGCGCGAACCGCTGACCAGATACGTATCGACAAGCTCAGCAGTGACAATGAAGCCATGCA
GAATCAGCTGAAGGCACTGGGCGTGAAACCGGCTGTCTCTGGTGGCGAGCCCGCGCCGACTCCTCCGTCA
CCGCCACCCGGTCCGGAAGGGGAGCCGCAGCCAGCCAGTTATCCGCCGCAAACCGGCGCCGCGGTACCGC
CTCCGACGGCATTCTATCCGGGGAATGGTATGACACCGCCGCCGCAGGTCAGCTACCAGTCTGTACCGGT
ACCAAACCAGATACAGCGTAAAACGTTCAGTTACGACAAAGGAAAAAAAACGAAGTCATTGCCGTACATT
CCGTCGGGGAGCTTTGCAAAAAGTATGCTTATCGAGGGGGCAGATGCCAACGCGTCTGTTACCGGGAATG
AATCAACTGTACCGATGCAGTTGCGTATCACTGGTCGCGTGGAAATGCCAAACAGCAAAACCTACGACCT
GACAGGGTGTTTTGTGGGCCTTGAAGCCTGGGGCGATGTCTCCAGCGAACGCGCCATTGTCCGTACCCGC
AATATCAGCTGTATCAAAGGTGATAAAACCATCGATCAGCCCATTAACGGCCACATTTCCTTTATGGGGA
AAAACGGGGTTAAGGGAGAGGTGGTGATGCGTAACGGAAAAATCCTCGGCTGGGCATGGGGGGCCGGTTT
TGTTGACGGGATTGGTCAGGGCATGGAACGGGCTTCACAGCCGGCTGTTGGCCTGGGGGCAACCGCATCT
GTTGGCGCCGGTGACGTTCTGAAAATGGGGGTCGGCGGTGGTGCATCTAAAGCTGCGCAGACGCTGAGCG
AGTACTACATCAAAAGGGCCGAGCAGTATCACCCGGTCATTCCGATTGGTGCCGGCAACGAAGTGACTGT
CGTGTTCCAGGATGGATTCCAGCTGAAAACGATTGAAGAGCTGGAAGCGGAAAAGAACGGGCAACAGCAG
GCTCAGAATCAGGAGGCGGGGCCGGCACCGCAGGCTGATGCCCATCATCAGTCAGGCGGCGGTATGAACG
GATTCAATACTGACGAGATGCTGAAGAAGCTGGGCAAACTTGATCCGCGGGAGTTCTCTCCGGGCGCAGC
GCCGCAGGGGGAAAATAATGGCTAA
 Primer design