SecReT4
Protein ID: 294496776
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p092
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]84130..84714 [+]
ProductF pilus assembly protein
Component typeTraV_F
UniProt IDD5KTR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 6.7e-40, Aligned region: 23..188
Protein Sequence: 194 a.a.     [Download]
>gi|294496776|ref|YP_003560469.1| F pilus assembly protein [Klebsiella pneumoniae]
MKELMLLIPLGGALLLTGCAGTETEFQCNATTSDTCMTMEQANEKAKLKEERSDAKPAAAGLPQLAEGNF
RTTSVNSYPLPPQSNLTQARVAAEKDRARAVYLNNPTAKNEATYFETEKRLQSLPVVKMSLPVVASTFTS
PSTPPGNYPRPLRKGEETTSLWIAPYVDSDDVYHQPATVLFVVKPSAWGQPRLN
 
Nucleotide Sequence: 585 bp     [Download]
>gi|294496685|ref|NC_014016.1|:84130-84714 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAAGGAATTAATGCTGTTAATTCCTCTGGGCGGCGCTTTGCTCTTAACCGGGTGCGCGGGCACAGAGA
CTGAATTTCAATGTAATGCCACGACGTCGGATACCTGTATGACGATGGAGCAGGCAAATGAAAAAGCGAA
GCTGAAAGAGGAACGCAGTGATGCAAAGCCGGCTGCGGCCGGGTTGCCACAACTGGCTGAGGGTAATTTC
AGAACCACGTCAGTGAATTCGTACCCGTTGCCGCCACAGTCCAACCTGACCCAGGCCAGAGTGGCCGCGG
AGAAAGATCGAGCACGTGCAGTGTACCTAAATAATCCAACGGCAAAGAATGAGGCAACATATTTCGAAAC
CGAGAAAAGGCTCCAGTCTTTGCCGGTAGTGAAAATGTCTTTACCAGTAGTGGCGTCAACGTTTACGTCA
CCGTCAACACCGCCAGGTAATTATCCTCGTCCATTAAGAAAAGGGGAGGAGACAACGTCATTGTGGATAG
CGCCGTATGTGGACTCAGATGATGTATATCACCAGCCAGCAACGGTTCTTTTTGTCGTAAAACCATCGGC
GTGGGGACAGCCTCGCCTTAATTGA
 Primer design