SecReT4
Protein ID: 294496783
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p099
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]87273..89912 [+]
ProductF pilus assembly protein
Component typeTraC_F
UniProt IDD5KTS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.5e-60, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 7.6e-42, Aligned region: 481..777
Protein Sequence: 879 a.a.     [Download]
>gi|294496783|ref|YP_003560476.1| F pilus assembly protein [Klebsiella pneumoniae]
MSNNIIDAVTQAVNSLVSALKLPDESAKANDTLGSMNFPQFSRILPYKDYDSATGLFINNKTIGFMFEAR
PLPGADKSIVATLEHLLRSKLPRGVPVSFHLVSSKLVGNDIDYGLREFRWSGKQAKKFNAITQAYYLRAA
ETKFPLPPALDLPLTLRNYRVYISCCVPRKKNSTTQIVEMENQIKILRASLGGAYIPTRILDAAGLVELM
RELINPDPHEMYRVPYKLDPYQDLNYQCVDDSFDMQVTAGHLKIGRLGRDGKECVTRVTSYHLESDPEMA
FLWTSADNYANLLNPELSISCPFVITLTLMVEDQVKTQNEANMKFMDVEKKSKTSYAKFFPNVIKEMQEW
GDIRQRLATNQTSLVSYFFNITTYTADSTEASLAAEQQVLNSYRKGGFQLIPARYHHLRNFLAMMPFKCG
EGLFKELQAAGVVKRAETFQVANLLPIVADSPLAPAGLLAPTYRNQLAFIDLFYEGMNNTNFNMAVCGTS
GAGKTGLIQPLIRSVLDSGGFAWVFDMGDGYKSLCENMGGVYLDGDTLKFNPFANVLDDAHFDMSAERIR
DQMSVMASPNGNLDEVHEGLLLQAVQAAWLSKRNHARVDDVVQFLQDAKDSDEYADSPTIRGRLDEMIIL
LDQYTVNGIYGDYFNSDKPTLHDDARMVVLELGGLESRPSLLIAVMFSLIIYIENRMYQSPRGLKKLNVI
DEGWKLLDFKNEKVGQFIEKGYRTARRHTGAYITITQNIVDFDSPTASSAARAAWGNSSYKAILKQSAKE
FAKYNQLYPDQFSKLEKDMINGFGSAKEQWFSSFMLQVEANCSWHRLFVDPLSRAMYSSKGPDFEYMQAR
RQEGVDIHDAVYGLACRNFKDEMAELESRIPVNDIEDKQ
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|294496685|ref|NC_014016.1|:87273-89912 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAGTAATAACATCATCGATGCCGTCACCCAGGCAGTGAATTCACTGGTATCAGCACTGAAGCTGCCCG
ACGAATCCGCGAAAGCCAATGACACGCTGGGCAGCATGAATTTCCCCCAGTTCAGCCGTATTTTGCCCTA
TAAGGATTATGATTCCGCGACCGGGCTGTTTATTAATAACAAAACCATCGGTTTTATGTTTGAGGCGCGT
CCTTTACCCGGTGCGGATAAAAGTATCGTCGCCACACTGGAGCATTTACTGCGCAGCAAACTTCCACGGG
GCGTCCCGGTCAGTTTTCATCTGGTCTCCAGCAAACTGGTCGGCAATGATATCGACTACGGTCTGCGTGA
ATTCCGCTGGAGCGGTAAACAGGCTAAGAAGTTTAACGCCATCACCCAGGCCTACTATCTCCGGGCAGCG
GAGACGAAGTTCCCCCTGCCTCCTGCACTGGATTTACCCCTGACGCTGCGTAACTACCGCGTGTACATCT
CCTGCTGCGTGCCCCGGAAGAAAAACTCCACCACGCAAATTGTGGAGATGGAGAACCAGATTAAAATCCT
GCGGGCGTCACTGGGCGGTGCCTATATTCCGACGCGTATCCTTGATGCTGCCGGGCTGGTCGAACTGATG
CGCGAGCTTATAAACCCGGACCCGCACGAGATGTACCGCGTACCGTATAAGCTGGACCCCTATCAGGATC
TGAACTATCAGTGTGTCGATGACAGCTTTGATATGCAGGTCACCGCCGGTCATCTGAAAATTGGCCGCCT
GGGGCGTGACGGGAAAGAGTGCGTAACCCGGGTGACGAGCTACCATCTGGAGAGTGATCCGGAAATGGCA
TTCCTCTGGACCTCCGCGGATAACTACGCCAACCTGCTTAACCCGGAGCTCTCCATCTCCTGCCCCTTTG
TCATCACGCTGACGCTGATGGTGGAGGACCAGGTGAAGACCCAGAATGAAGCCAACATGAAATTCATGGA
CGTGGAGAAGAAAAGCAAAACCTCCTACGCGAAGTTTTTTCCGAACGTGATAAAGGAAATGCAGGAGTGG
GGCGATATCCGCCAGCGACTGGCGACCAACCAGACCTCCCTGGTGTCCTACTTCTTTAATATCACCACGT
ACACCGCAGACAGCACAGAGGCCTCTCTCGCCGCTGAACAGCAGGTGCTCAACAGTTACCGTAAAGGCGG
TTTCCAGCTGATCCCGGCCCGCTACCATCACCTGCGTAACTTTCTGGCCATGATGCCGTTCAAGTGTGGT
GAGGGCCTGTTTAAAGAGCTGCAGGCGGCAGGCGTGGTGAAGCGGGCGGAGACGTTCCAGGTGGCTAACC
TCCTGCCGATCGTCGCTGACAGCCCGCTGGCGCCGGCGGGACTCCTGGCGCCCACCTACCGAAATCAGCT
GGCGTTCATCGACCTGTTCTACGAGGGAATGAACAATACCAATTTCAACATGGCAGTCTGCGGGACGTCC
GGGGCGGGTAAAACCGGTCTGATTCAGCCCCTCATTCGCAGTGTGCTCGACTCCGGCGGGTTTGCCTGGG
TGTTCGACATGGGCGATGGCTATAAGTCCCTGTGTGAAAACATGGGGGGCGTATACCTCGATGGCGATAC
CCTCAAGTTTAACCCGTTCGCCAACGTGCTGGATGATGCTCACTTCGACATGTCAGCAGAACGTATACGC
GATCAGATGTCTGTCATGGCCAGTCCGAACGGCAACCTCGATGAAGTCCATGAAGGCCTGCTTCTGCAGG
CAGTGCAGGCGGCCTGGTTAAGCAAGCGTAATCATGCACGCGTTGATGACGTAGTGCAGTTTTTACAGGA
CGCGAAGGACAGCGATGAATATGCTGATTCCCCGACAATCCGGGGCCGTCTGGACGAGATGATAATCCTG
CTCGATCAGTACACGGTGAATGGGATCTACGGGGACTATTTCAACTCAGATAAACCAACACTCCACGATG
ATGCCCGGATGGTGGTACTGGAACTCGGTGGCCTGGAGTCGAGGCCCTCTCTGCTTATCGCTGTGATGTT
TTCATTGATTATTTACATCGAGAACAGGATGTATCAGTCACCGCGTGGCCTGAAAAAACTGAACGTCATC
GATGAGGGCTGGAAGCTCCTTGATTTCAAGAATGAAAAAGTGGGGCAGTTTATCGAGAAAGGCTACCGTA
CCGCGCGTCGACATACCGGCGCATACATCACCATCACGCAGAACATCGTCGACTTCGACTCCCCGACCGC
CTCCAGCGCCGCACGTGCAGCGTGGGGGAACTCGTCGTACAAGGCCATTCTGAAGCAGTCAGCGAAGGAA
TTTGCCAAGTATAACCAGCTGTACCCGGATCAGTTCAGCAAGCTGGAGAAAGACATGATTAACGGCTTCG
GTTCGGCCAAAGAGCAGTGGTTCTCCTCTTTTATGCTGCAGGTGGAAGCGAACTGCTCCTGGCACCGCCT
GTTCGTTGACCCGCTCAGCCGGGCGATGTACTCCTCCAAAGGCCCGGATTTTGAGTACATGCAAGCGCGC
CGGCAGGAGGGGGTCGATATCCACGATGCGGTATACGGACTGGCGTGCCGCAACTTTAAAGACGAAATGG
CAGAGCTTGAATCCCGAATACCGGTGAATGACATCGAGGATAAACAGTGA
 Primer design