SecReT4
Protein ID: 294496785
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p101
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]90301..90927 [+]
ProductF pilus assembly protein
Component typeTraW_F
UniProt IDD5KTS3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 2e-07, Aligned region: 7..32
Protein Sequence: 208 a.a.     [Download]
>gi|294496785|ref|YP_003560478.1| F pilus assembly protein [Klebsiella pneumoniae]
MLRLKGCLLAACLLSPLTQAADLGTWGDLWPVREQDMLQLITQRLQSLQSSGQWDQTMDAFKQRVIENSQ
RPAPVEGIKRAEKYEQRWFDPSIRLTEDLKDNEGRVFARKGDVVNPLKTVPFVQTLYFINGDDADQLAWM
KRQVPETLMSKIILVRGSIPDTSAALDSRIYFDQNGVLSKRFGLTAVPARITPAPSGERLNIEVFPVR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|294496685|ref|NC_014016.1|:90301-90927 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGTTACGACTGAAAGGCTGTCTGCTCGCCGCCTGTCTGCTATCGCCGCTGACTCAGGCGGCTGATCTCG
GTACCTGGGGGGATTTATGGCCCGTCCGGGAGCAGGACATGCTGCAGCTCATCACGCAGCGTCTGCAGTC
GCTGCAATCTTCTGGCCAGTGGGACCAGACGATGGATGCGTTTAAGCAGCGGGTTATCGAGAACAGTCAG
CGTCCGGCACCGGTGGAGGGCATTAAGCGTGCGGAGAAATACGAGCAGCGCTGGTTTGATCCCAGCATCC
GCCTGACCGAAGACCTGAAGGACAATGAGGGGCGGGTGTTTGCCCGCAAGGGCGATGTGGTGAACCCGCT
TAAAACCGTACCGTTTGTCCAGACCCTGTACTTCATCAATGGAGACGATGCCGACCAGCTGGCCTGGATG
AAGCGTCAGGTGCCGGAAACCCTGATGAGCAAAATTATCCTGGTGCGTGGCAGTATCCCGGACACCTCCG
CAGCGCTGGACAGCCGGATCTATTTCGACCAGAACGGTGTACTGAGCAAGCGATTTGGCCTGACGGCGGT
CCCGGCGCGGATCACGCCGGCGCCCTCCGGTGAACGGCTGAATATTGAGGTGTTTCCCGTCCGTTGA
 Primer design