SecReT4
Protein ID: 294496787
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p103
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]91355..92344 [+]
ProductF pilus assembly protein
Component typeTraU_F
UniProt IDD5KTS5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1e-84, Aligned region: 28..328
Protein Sequence: 329 a.a.     [Download]
>gi|294496787|ref|YP_003560480.1| F pilus assembly protein [Klebsiella pneumoniae]
MRKISFLFILLFFSLVPQVHADPSCEGRFVNPITDVCWRCIFPLSLGSVQVGKGDLPDTSNPGSPLQLCP
APPPLFVRPGLAIGYWEPMAMTDVSRSPGCMVNLGGFSINLGKTGMGTARKDDKQVNGAFYHVHWYKYPL
TYWLNIITSAGCLEGGDMDIAYLSEIDPTWVDSSLTTILNPEAILFANPIAQGACAADAMASAFHMPLDI
LFWCAGSQGSMYPFSGWVSNESSPLQSSLLVSERMAYKLHRQGQIMESIGKDKAVCYEYPSPIIPKERWR
YQMVNMYPDSGQCHPVGRSVMRWEAGKNPPNTRKNYGYLMWRKRNCVFL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|294496685|ref|NC_014016.1|:91355-92344 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAGAAAAATATCATTTTTGTTTATCCTCCTGTTTTTTTCGTTAGTCCCTCAGGTACATGCAGATCCGT
CGTGTGAAGGTCGATTCGTCAACCCGATCACCGATGTGTGCTGGCGCTGCATATTTCCTTTATCACTCGG
CAGCGTGCAGGTTGGTAAAGGCGATCTGCCTGATACCAGCAATCCGGGTAGTCCCCTGCAGCTGTGTCCG
GCGCCGCCACCGCTTTTTGTTCGTCCCGGCCTGGCCATCGGGTACTGGGAACCGATGGCCATGACGGACG
TCAGCCGTTCGCCAGGCTGTATGGTCAATCTGGGGGGCTTCAGTATCAATCTCGGCAAGACCGGCATGGG
GACCGCGAGAAAGGACGATAAGCAGGTGAACGGCGCCTTCTATCACGTTCACTGGTACAAGTACCCGCTG
ACGTACTGGCTGAACATCATCACTTCGGCAGGGTGTCTGGAAGGCGGAGACATGGATATAGCCTATCTGT
CCGAGATTGACCCGACCTGGGTGGACAGCAGCCTCACCACCATTCTGAATCCGGAAGCCATCCTGTTTGC
CAACCCCATCGCACAGGGGGCGTGCGCGGCTGACGCTATGGCCAGCGCGTTTCATATGCCACTCGATATT
CTGTTCTGGTGTGCCGGCTCTCAGGGTTCGATGTACCCGTTTAGCGGCTGGGTAAGCAACGAGTCCAGTC
CGCTGCAGTCCTCGTTACTTGTCAGCGAGCGCATGGCGTACAAGCTTCACCGGCAGGGACAAATTATGGA
GAGCATCGGGAAGGACAAGGCGGTCTGCTATGAGTATCCGTCCCCGATCATCCCCAAAGAGCGCTGGCGC
TATCAGATGGTGAACATGTACCCGGACAGCGGCCAGTGCCATCCCGTGGGGCGCAGCGTGATGCGCTGGG
AGGCCGGTAAAAATCCACCCAACACCCGTAAGAACTATGGCTATCTGATGTGGCGTAAACGCAATTGTGT
CTTTCTCTGA
 Primer design