SecReT4
Protein ID: 294496788
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p104
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]92357..92995 [+]
Productpilus assembly protein
Component typeTrbC_F
UniProt IDD5KTS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 8e-29, Aligned region: 90..188
Protein Sequence: 212 a.a.     [Download]
>gi|294496788|ref|YP_003560481.1| pilus assembly protein [Klebsiella pneumoniae]
MKLMNLFMVMLLLTGRAVLAETSSVTDREWLKQQETLSEQLRQHPDKQLQQELEAQINRNPLPKSDRQFI
DNLVSQQKAANQEKPAEGALYFVSFSIPEEGLKRMLHETRQYGIPATLRGLVNNDMKTTTDAVLQLVKDG
VTDGVQIDPTLYTQYSIRSVPSLVVRCQAGYDVVRGNIHVKQALEKVAQTGDCAQVARQMLDAPSNAAGS
QP
 
Nucleotide Sequence: 639 bp     [Download]
>gi|294496685|ref|NC_014016.1|:92357-92995 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAAATTAATGAATCTGTTTATGGTCATGCTTTTGCTGACCGGACGAGCGGTGTTGGCTGAAACCTCCT
CTGTTACAGACAGAGAATGGCTGAAGCAGCAGGAGACCCTCAGCGAACAGCTGCGCCAGCATCCGGATAA
ACAGCTGCAGCAGGAGCTTGAGGCGCAAATCAACCGTAATCCTCTGCCCAAATCAGACCGCCAGTTTATC
GATAATCTGGTCAGCCAGCAGAAAGCGGCGAATCAGGAAAAGCCGGCAGAAGGGGCGCTGTACTTTGTCT
CCTTCTCGATACCTGAAGAGGGGCTGAAGCGGATGCTGCACGAAACCCGGCAGTACGGCATTCCGGCGAC
ACTGCGTGGGCTCGTCAATAACGACATGAAGACCACCACTGACGCGGTGCTGCAGCTGGTGAAGGATGGC
GTGACCGACGGCGTGCAGATCGACCCGACACTGTACACGCAGTACAGCATCCGGAGTGTGCCGTCTCTGG
TGGTACGGTGTCAGGCCGGATATGACGTGGTACGCGGTAACATTCACGTCAAACAGGCGCTGGAGAAAGT
GGCACAAACCGGTGACTGCGCACAGGTGGCCCGGCAGATGCTTGATGCGCCCTCGAATGCCGCCGGGAGC
CAGCCATGA
 Primer design