SecReT4
Protein ID: 294496789
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p105
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]93054..95009 [+]
Productaggregate stability
Component typeTraN_F
UniProt IDD5KTS7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.1e-71, Aligned region: 354..600
Protein Sequence: 651 a.a.     [Download]
>gi|294496789|ref|YP_003560482.1| aggregate stability [Klebsiella pneumoniae]
MKTVISVLTAHFFVLSAFIWLASPACADRGSDYKAGSDFAKQVQGNGLNSLKNFSGEQNLPGYTDSPDQT
KYYGGVTASGDSSLKSDSALEFSQGDTGKAITESFTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQS
CTAQVVNRSEFTNHTCERDLQVENFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNG
RLLNASVDGEPLVIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVINWPRSESMCSGGQNTHCTKY
TYDGKGKIHQSFGVDKAVTAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETETVYAPEVVWVESCPFSK
DEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSCESLMKNTACTLSSRQCAFSSE
EGTCLHEYATYSCETRTSGKQMICGGDVFCLDGECDKATSGKSNDFGQAVSELAALAAAGKDVAALNGVD
VRAFTGKAKFCKKFAAGFSNCCKDSGWGQDVGLARCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEK
KRSYCQFDSKLAQIVQQQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKNQKIPEN
DVLTNKTRERIKEIMSQQSAQ
 
Nucleotide Sequence: 1956 bp     [Download]
>gi|294496685|ref|NC_014016.1|:93054-95009 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAAGACGGTTATTTCCGTGCTGACTGCGCATTTTTTTGTCCTGAGCGCCTTTATCTGGCTGGCATCCC
CAGCCTGTGCTGACAGAGGAAGCGACTATAAAGCTGGTTCGGATTTTGCGAAACAGGTGCAGGGCAATGG
TCTGAACTCACTGAAAAATTTCAGTGGTGAGCAAAACCTGCCGGGGTATACCGACAGCCCTGATCAGACA
AAATACTATGGCGGCGTCACTGCCAGCGGAGACAGCTCTCTGAAAAGCGATTCAGCCCTGGAGTTCAGCC
AGGGAGATACCGGCAAAGCGATTACGGAGTCGTTCACGAACCGGCCACCGGATCAGATATCTCAGGATGC
GCCGTTTATTCAGGCCGCAAAGGATACAGAATCCCGTGCCGACAGCATTGTCGGCGATACCGGACAGTCC
TGTACCGCCCAGGTTGTGAACCGCAGTGAGTTCACAAACCATACCTGCGAACGTGATCTGCAGGTGGAAA
ATTTTTGCACACGGGAAGCGACCCTGAAGGATAACGCCACCACACAGAAAGTTAACCGAACCTATCAGCA
GGTGGTGACGCTGAATTATGCCCGGAGTACCCGGCAATGGAGTGGCAACCTGACGATCCCGACCAACGGT
CGTCTGCTGAATGCCTCGGTGGATGGTGAGCCTCTGGTGATCCCCTGGATTGAAGAATGCGATTCCGAAG
GGAAGGTGCGGGATAGCTGCAAGAGTGCAGTGAGTGAAAGCCTGACCCTCTTTGAACGAACGTTCCCCAT
TGATGTGATCAACTGGCCACGTTCAGAATCGATGTGTTCAGGCGGTCAGAACACGCATTGTACGAAATAT
ACCTATGACGGGAAGGGGAAGATTCATCAGTCGTTTGGTGTGGACAAAGCGGTCACTGCTGGGCAGAACT
TTTCAGTAAGCAAAACATCACGGACCGTATCATCGGCCAGCCAGAAACCCGTACAGGTCACGGTCACCCT
GGTGATGGAAGAAACCGAAACCGTCTATGCACCTGAAGTCGTCTGGGTTGAAAGCTGTCCGTTCAGTAAG
GATGAAGGAAAAAAAACGGGCGAGGAATGTATCAGTCCGGGAGGAACGCGAACCATCACCCTCGGAGGCA
GGGATTACTCGTTCACGGAGGCCTGCTGGAAATATAAGGATACCTGGCTCACGCAGCCGGCGGACAACGG
CTCCTGTGAAAGCCTGATGAAAAATACGGCCTGTACTCTGTCATCCCGCCAGTGCGCCTTCTCCAGCGAG
GAAGGCACGTGCCTGCATGAATATGCAACGTATTCCTGCGAAACCAGGACGAGTGGCAAGCAAATGATCT
GCGGCGGTGATGTCTTCTGCCTTGATGGTGAATGTGACAAAGCCACGTCCGGGAAGAGCAACGACTTTGG
GCAGGCGGTGTCTGAGCTGGCGGCACTGGCTGCCGCGGGGAAGGACGTCGCGGCACTGAACGGGGTGGAT
GTCCGGGCATTCACCGGAAAAGCGAAGTTCTGTAAGAAGTTTGCTGCCGGCTTCAGTAACTGCTGCAAAG
ACAGCGGCTGGGGCCAGGATGTGGGGCTGGCACGCTGCAGCAGCGAGGAAAAGGCGCTGGCCAAAGCGAA
AAAAGACAAGCTGACGGTCAGTATAGGGGAATTCTGCTCTAAAAAGGTTCTGGGGATTTGCCTGGAGAAA
AAAAGGAGCTATTGCCAGTTCGACTCAAAACTGGCGCAGATCGTTCAGCAGCAGGGAAGAAACGGTCAGC
TGCATATCGGTTTTGGCGGCGCCAGCAGTCCTGACTGTCGGGGCATTACCGTCGCGGAACTCCAGGGGAT
TGATTTTAACAAGCTGGATTTCACCAACTTTATGGACGACCTGATGAAAAATCAAAAAATACCGGAAAAC
GATGTGCTCACCAATAAGACCAGAGAACGAATTAAGGAAATCATGAGTCAGCAATCCGCGCAATAA
 Primer design