SecReT4
Protein ID: 294496793
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p109
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]95881..96633 [+]
ProductF pilus assembly protein
Component typeTraF_F
UniProt IDD4HQL7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.4e-77, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|294496793|ref|YP_003560486.1| F pilus assembly protein [Klebsiella pneumoniae]
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLY
EAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAI
STLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFP
AMMLVNPKSGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|294496685|ref|NC_014016.1|:95881-96633 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGCGAACAATACATGCCGCCATGCTGGCGGGGTGCCTTTGCTGCGCCCTGATGCCGGCTTTCGCCAAAG
ACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACAGGAAAGCCGTACCAGCGGC
ACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGCCACCAAACGGTCGTTGTAC
GAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTGCAGAACTACTGGACGCAGC
AGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCGAACTCGATTACAACCTGCA
GTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGCCGAACAGCGACAGGCTATC
TCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAAGCGATCGATGGCCAGCTGG
TCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGGTGTCGGTTGACGGAGTGAT
TAACCCCATGCTGCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCTTGGCGTGAAGTTCTTCCCC
GCGATGATGCTGGTTAACCCGAAAAGTGGCCAGGTGAAGCCTCTCAGTTACGGCTTTATCAGTCAGGACG
ACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCTAA
 Primer design