SecReT4
Protein ID: 294496794
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p110
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]96644..96883 [+]
ProductF pilin synthesis
Component typeTraQ_F
UniProt IDD5KTT2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.8e-35, Aligned region: 1..71
Protein Sequence: 79 a.a.     [Download]
>gi|294496794|ref|YP_003560487.1| F pilin synthesis [Klebsiella pneumoniae]
MRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRILNALIAEAEKEEKA
CEKQPDEPR
 
Nucleotide Sequence: 240 bp     [Download]
>gi|294496685|ref|NC_014016.1|:96644-96883 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGCGAAATATTCGTTTTCCGGATTTAGATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCC
ACCTGATAGCCCGGCTTGTCAGAAAACAGCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGG
TATGGTGGTGTTCGGGGGATACCGCATTCTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCC
TGTGAAAAACAGCCTGATGAACCTCGCTAA
 Primer design