SecReT4
Protein ID: 294496797
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p113
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]97867..99258 [+]
ProductF pilus assembly protein
Component typeTraH_F
UniProt IDD5KTT5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5.1e-118, Aligned region: 36..385
Protein Sequence: 463 a.a.     [Download]
>gi|294496797|ref|YP_003560490.1| F pilus assembly protein [Klebsiella pneumoniae]
MLCVMEDWMRIKLLSLFCGAVLGLSFSAAADVNGDMNNFFNKLGFASNTSQPQVWQGQAAGYASGGSLYA
RTQVKTIQLVSMTLPDINAGCGGIDAYLGSFSYINSEQLQRFAKQIMSNAAGYFFDLALQTTVPEIKTAK
DFLQKMATDMNSMNLSSCQAAQGIVGGLFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGGKMDSVQ
DKASDKDKERVMKNINIMWNALSKNRLFDGNKELKEFIMTLTGTLIFGENSEITPLPARTTDQDLIRAMM
EGGTAKIYHCNDSDKCLKVVADATVTITSSKALKSQISALLSSIQNKAVADEKLTDQEKGFISSTTIPVF
KYLVDPQMLGVSNSLIYQLTDYIGYDILLQYIQELIQQARAMISTGNYPQSTMDMIMENLNQASVQIAAF
QSRVQVQQDALLVVDRQMSYMRQQVSARMMTRYQNNYHFGGNL
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|294496685|ref|NC_014016.1|:97867-99258 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGCTGTGCGTAATGGAGGACTGGATGCGAATTAAACTTCTGTCACTCTTCTGCGGTGCCGTGCTTGGCC
TGTCATTTAGCGCCGCCGCCGACGTGAATGGCGATATGAACAACTTCTTCAATAAGCTGGGCTTTGCGTC
CAATACCAGCCAGCCGCAGGTCTGGCAGGGACAGGCTGCGGGTTACGCCTCCGGCGGTTCGCTGTATGCC
AGAACGCAGGTGAAAACGATCCAGCTGGTCAGCATGACGCTCCCTGATATTAATGCCGGCTGCGGAGGGA
TTGATGCCTATCTGGGGTCATTCAGCTATATCAACAGCGAGCAGCTGCAGAGGTTCGCAAAACAAATCAT
GAGCAACGCCGCGGGGTACTTTTTTGATCTCGCTTTGCAAACCACGGTACCGGAGATTAAAACCGCAAAG
GACTTCCTTCAAAAGATGGCCACTGACATGAACAGCATGAACCTCAGTTCCTGCCAGGCTGCTCAGGGAA
TTGTGGGTGGCCTGTTTCCTCGTACCCAGGTCGCTCAACAAAAGGTCTGCCAGGACATTGCCGGTGAAAG
CAATATCTTTTCGGACTGGGCCGCGTCGCGCCAGGGTTGTACGGTGGGCGGCAAGATGGACAGCGTCCAG
GATAAGGCCAGCGATAAAGACAAAGAACGTGTGATGAAAAACATCAACATCATGTGGAATGCCTTATCGA
AGAACCGGCTCTTCGACGGCAATAAGGAGCTGAAGGAATTCATCATGACGCTCACCGGTACGCTGATTTT
CGGGGAGAACAGTGAAATCACGCCGCTGCCGGCACGCACCACTGACCAGGATCTGATTAGAGCCATGATG
GAGGGCGGCACGGCTAAAATCTACCACTGCAATGATTCGGATAAGTGTCTTAAGGTCGTTGCTGATGCGA
CCGTGACCATCACTTCCAGTAAAGCGCTAAAAAGCCAGATTTCCGCTTTGTTAAGCAGTATCCAGAATAA
AGCAGTGGCTGATGAAAAACTGACGGATCAGGAGAAAGGGTTTATCTCCAGCACCACCATTCCGGTATTC
AAATACCTGGTCGATCCGCAGATGCTCGGGGTGTCTAACTCACTTATTTACCAGCTGACGGACTATATCG
GCTACGACATCCTGCTGCAGTACATTCAGGAACTTATCCAGCAGGCCCGGGCGATGATTTCAACCGGTAA
TTATCCCCAGTCGACAATGGATATGATCATGGAAAACCTCAATCAGGCGAGTGTCCAGATTGCCGCTTTT
CAGTCCCGTGTTCAGGTTCAGCAGGACGCCTTGCTTGTGGTTGACAGGCAAATGAGTTACATGCGCCAGC
AGGTCTCTGCCCGCATGATGACCCGCTACCAGAATAACTATCATTTTGGGGGGAATCTGTAA
 Primer design