SecReT4
Protein ID: 294496798
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p114
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]99258..102107 [+]
ProductF pilus assembly and aggregate stability protein
Component typeTraG_F
UniProt IDD5KTT6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.6e-125, Aligned region: 3..451
Protein Sequence: 949 a.a.     [Download]
>gi|294496798|ref|YP_003560491.1| F pilus assembly and aggregate stability protein [Klebsiella pneumoniae]
MLEIYAIAGGDWLRGNLNAIAAFMGTSTWSTIEKMCIAISVLIVAGNWVKKHNVMDLIGWVFSLTLVSML
VVIRTPVQIIDYSNVAQVYEVDNVPIGLAIPASLTTRVGNALIQSYEMVFALPDSVTYSKTGMLFGSNLV
AKSTDFLSQNPQITTLFSDYVQNCVMGDIFLNHKYSFEELLNSPDPYTLIFANPSPLRGVFDKNNQFQTC
EEASRDLKSALALDTQTGGKTWNYYVRQLFGGKPNPDLLFSQMIGDSYNYFYSSGQSAGQIIRQNVTMNA
LRSGIQSYAARSGDTASLVNIANTSSLEKQRLAQATMGHQALRTLPLMQTVIMGIMIGMFPIMVMAAMFN
MMTLQVLKGYVFALIWLQTWPLLFAILNSAMAYYAKQNGVPVVLSELSQVQLKNSDIATTAGYIAVMIPP
LSWGIVKSMGAAFSSAYSHFSSSGLGATSQAASGVVDGNYSFANMQMENVSGYSWGTNSTTSFGQMSRQL
ANGGMSTQTRDGSMVWDSGGAMSKLPVDINVGRQIASAQQQMAREADVQAESALHGYNSSVTSAWNVLKQ
FGTNRGTSSSMTTGADNTESSQDTMAKSKMWNAVVANAKANNISNEQSFQNLMDESTRGTVTGEAHVGAR
WSSGDQLAGKIGKLATGASVEGGIKGSISGSGSTGSTDTVGQSGRHSSDSRHDISSQAAKDFREASDYLV
SHKTNTSGNITDNNASSRVDQFAASLSSAKNSYDQYTTSRTRSHEYSEMASRTESLTGQMSENLTQQFAN
FVQHRAPQDAEAILTNTSSPEIAAQREMLAREFVKAQVEPRIDSSFEQGRNDIGNGMASVSGTPGDQTVV
SDFGKHSGDIESMSRNSGIKENVRNQVDSMVEDNTRINNAGKINIKEQGEGIKQQNADFEMLHKKEGNDF
NERYNKELNGQVNNPLSNTTEEFRKKAEESARKMDGKLP
 
Nucleotide Sequence: 2850 bp     [Download]
>gi|294496685|ref|NC_014016.1|:99258-102107 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGCTTGAGATATATGCCATTGCTGGCGGCGACTGGTTACGGGGCAACCTGAACGCGATTGCGGCGTTTA
TGGGGACCAGCACATGGTCGACTATAGAAAAGATGTGTATCGCCATCTCGGTACTCATTGTGGCGGGGAA
CTGGGTAAAAAAACACAACGTAATGGACCTTATTGGCTGGGTCTTTTCCCTCACCCTGGTCTCTATGCTG
GTTGTCATTCGTACCCCTGTGCAGATCATCGATTACAGTAACGTTGCGCAGGTCTATGAAGTCGATAATG
TTCCTATTGGTCTTGCCATTCCTGCGTCGCTGACAACGAGGGTGGGAAACGCGCTTATCCAGAGTTATGA
GATGGTCTTCGCGCTGCCGGACAGCGTCACGTACAGTAAAACGGGGATGTTATTTGGCAGTAATCTGGTC
GCGAAAAGTACGGATTTTTTGTCACAAAATCCTCAGATTACGACGCTGTTTTCCGATTACGTACAAAACT
GTGTGATGGGCGATATTTTCCTCAATCATAAGTACTCTTTTGAAGAATTACTGAATTCTCCTGATCCGTA
TACCCTGATTTTTGCTAACCCGAGTCCACTGCGTGGCGTGTTTGATAAAAACAACCAGTTCCAGACATGC
GAGGAGGCCTCACGGGATCTGAAATCGGCTCTTGCGCTGGATACTCAGACAGGCGGTAAAACCTGGAACT
ACTATGTTCGTCAGCTGTTTGGCGGCAAACCTAATCCCGATCTGCTGTTCAGCCAGATGATTGGCGACAG
CTACAATTACTTCTACAGCTCGGGACAGAGCGCCGGGCAGATTATCCGCCAGAACGTCACGATGAACGCC
CTGCGCAGCGGGATCCAGAGTTATGCAGCCCGCAGCGGCGATACCGCCAGTCTGGTCAATATCGCTAACA
CCTCATCCCTTGAAAAGCAGCGGCTGGCACAGGCCACAATGGGGCACCAGGCGCTTCGCACACTTCCGCT
GATGCAGACCGTTATCATGGGGATAATGATTGGGATGTTCCCGATCATGGTGATGGCCGCCATGTTTAAT
ATGATGACGCTGCAGGTGTTAAAGGGGTATGTGTTTGCGCTTATCTGGCTGCAGACGTGGCCATTACTGT
TCGCCATCCTGAACAGCGCAATGGCCTACTATGCGAAGCAAAATGGCGTCCCGGTTGTTCTCTCTGAGTT
GTCGCAGGTTCAGCTCAAAAACTCGGATATTGCGACCACCGCGGGTTATATTGCCGTGATGATACCGCCT
TTGTCGTGGGGGATCGTGAAGAGCATGGGAGCCGCCTTCTCCAGTGCCTACAGCCATTTTTCTTCTTCCG
GGCTTGGTGCAACATCGCAGGCGGCTTCCGGCGTGGTGGATGGCAATTACTCGTTTGCCAACATGCAGAT
GGAGAACGTCAGCGGCTACAGCTGGGGTACCAACAGCACAACCAGTTTCGGACAGATGTCGCGGCAGCTG
GCGAATGGAGGCATGAGCACGCAGACGCGGGATGGCTCGATGGTCTGGGACAGTGGTGGTGCAATGTCAA
AACTGCCGGTGGATATCAACGTCGGTCGTCAGATAGCCAGTGCGCAGCAACAGATGGCCCGTGAGGCTGA
TGTCCAGGCCGAAAGCGCGCTGCATGGCTATAACAGCAGCGTGACAAGTGCCTGGAATGTTTTAAAGCAG
TTTGGTACCAACAGAGGAACCAGTTCCTCAATGACGACTGGAGCAGATAATACAGAGTCGTCGCAAGACA
CAATGGCTAAAAGTAAGATGTGGAATGCGGTGGTTGCTAATGCAAAAGCAAATAATATATCTAATGAGCA
GTCCTTTCAGAATCTCATGGATGAATCCACTAGAGGTACAGTTACAGGTGAAGCCCATGTGGGTGCAAGA
TGGAGTTCAGGAGATCAGCTTGCTGGTAAAATTGGGAAATTGGCTACAGGCGCCAGTGTAGAAGGTGGCA
TAAAAGGATCAATAAGTGGGAGCGGCAGCACAGGATCAACTGATACTGTTGGCCAGTCTGGTCGACATTC
CAGCGATAGCAGACATGATATAAGTAGTCAGGCCGCTAAAGATTTTAGAGAGGCAAGTGATTATCTTGTT
AGCCATAAAACTAATACTTCAGGTAATATAACTGATAACAATGCAAGCTCTCGTGTCGATCAGTTTGCTG
CTTCACTTTCTAGTGCTAAAAATAGTTACGACCAGTACACAACCAGTAGAACACGCAGCCATGAATATAG
TGAAATGGCTTCAAGAACTGAGAGTTTGACTGGCCAGATGAGCGAGAATCTCACTCAGCAATTTGCGAAC
TTTGTTCAGCATCGTGCTCCACAGGATGCTGAGGCCATTCTGACCAATACAAGCTCTCCTGAAATTGCAG
CGCAGCGTGAGATGCTGGCACGAGAGTTTGTGAAAGCTCAAGTAGAACCACGAATCGACAGTTCCTTTGA
ACAAGGAAGAAATGATATAGGTAATGGTATGGCAAGTGTTTCCGGGACGCCAGGTGACCAAACTGTTGTT
AGCGATTTTGGCAAGCACAGTGGTGATATTGAGTCAATGTCACGAAATTCTGGTATTAAAGAGAACGTAA
GAAATCAAGTGGATTCTATGGTGGAAGATAACACCAGGATAAATAATGCTGGTAAAATCAATATCAAAGA
GCAAGGTGAAGGGATTAAACAACAGAATGCAGATTTTGAGATGTTACATAAAAAAGAAGGAAATGACTTT
AATGAGCGATATAATAAGGAATTGAATGGTCAAGTGAACAATCCACTAAGCAACACGACTGAGGAGTTCA
GGAAGAAGGCTGAAGAATCTGCAAGGAAAATGGATGGTAAATTACCATAA
 Primer design