SecReT4
Protein ID: 294496802
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p118
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]104593..106905 [+]
Productconjugal transfer protein
Component typeTraD_F
UniProt IDD5KTU0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.3e-146, Aligned region: 172..561
TraD_N [PF12615], Evalue: 4.2e-32, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 9.6e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 6.2e-09, Aligned region: 400..491
T4SS-DNA_transf [PF02534], Evalue: 1.9e-06, Aligned region: 392..507
Protein Sequence: 770 a.a.     [Download]
>gi|294496802|ref|YP_003560495.1| conjugal transfer protein [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|294496685|ref|NC_014016.1|:104593-106905 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAGTTTCAATGCCAAAGATATGACGCAGGGCGGTCAGATCGCCAATATGCGCTTTCGCATGTTTGGTC
AGATTGCCAATATTATTTTCTACGTGCTGTTTATTTTATTCTGGGTGCTGTGCGGACTGATGCTGATGTA
CCGGCTCAGCTGGCAAACCTTTGTGAACGGCTGCGTATACTGGTGGTGTACGACGCTGGGTCCGATGCGC
GATATTATTCGTTCCCAGCCGGTATACACCATTCAGTATTACGGCCAGTCGCTGGAATATACCTCAGAAC
AAATCCTGGCCGATAAATATACTATCTGGTGCGGAGAGCAGCTGTGGACTGGTTTCGCCTTTGCTGCCGT
GGTTTCTCTTGTTATCTGTATCGTGACGTTCTTCATCGCCAGCTGGGTGCTGGGCCGCCAGGGGAAACAG
CAGAGTGAGGATGAGAACACCGGCGGGCGCCAGCTTTCCGATAAGCCCAAAGAAGTGGCCCGCCAGATGA
AGCGTGATGGAGTGGCCTCCGATATTAAGATTGGCGACCTGCCTATTCTTAAAAACTCCGAAATTCAGAA
CTTCTGCCTCCACGGTACCGTGGGTTCCGGTAAATCCGAAGTTATACGCCGGCTACTGAACTACGTGCGT
GCCCGGGGCGATATGGCCATCATTTACGATCGCTCCTGTGAGTTCGTCAAAAGCTATTACGACCCGTCAC
TGGATAAAATCCTCAACCCGCTGGACTCGCGCTGTGCAGCCTGGGATTTGTGGAAAGAGTGCCTGACGCT
GCCGGACTTCGACAACATCTCCAACACCCTTATCCCGATGGGTACCAAAGAAGATCCGTTCTGGCAGGGC
TCCGGTCGCACTATCTTTGCCGAAGGCGCGTATCTGATGCGCGAAGACGACGATCGGAGCTACGAGAAGC
TGGTCGATACCATGCTGTCCATTAAGATCGACAAGCTGCGCGCCTATCTGCAGAACACGCCGGCAGCGAA
CCTGGTTGAAGAGAAAATTGAGAAAACCGCCATCTCCATTCGAGCTGTGCTGACCAACTACGTCAAGGCT
ATTCGCTACCTGCAGGGCATTGAGAAGAACGGCGAGCCGTTCACTATCCGGGACTGGATGCGCGGCGTCC
GTGAGGACCGACCCAATGGCTGGCTGTTTATCTCCTCCAATGCTGACACCCATGCCTCCCTGAAGCCGGT
TATCTCGATGTGGCTGTCGATTGCCATCCGCGGCCTCCTGGCGATGGGCGAGAACCGTAACCGGCGTGTG
TGGATCTTCGCTGACGAACTTCCCACGCTGCACAAGCTGCCGGACCTGGTCGAAATCCTCCCGGAGGCGC
GTAAATTTGGTGGTTGTTATGTGTTCGGTATTCAGTCTTATGCCCAGCTGGAAGACATCTATGGCGTTAA
GCCTGCCGCCACGCTCTTTGACGTGATGAACACCCGGGCCTTCTTCCGCTCCCCGAGTAAAGAGATTGCG
GAGTTTGCTGCCGGTGAAATTGGTGAGAAGGAAATCCTCAAGGCCAGCGAGCAGTACTCCTACGGTGCTG
ACCCGGTGCGTGATGGTGTATCGACCGGGAAAGAAAAAGAGCGGGAAACGCTGGTCAGTTACTCCGATAT
TCAGACGCTGCCTGACCTGTCCTGTTACGTCACGCTGCCCGGGCCGTATCCGGCCGTGAAACTGGCCCTC
AAATACAAGCCGCGTCCGAAAATTGCCGAGGGATTTATTCCTCGCACTCTCGATGCGCGGGTGGATGCAC
GGCTCAGTGCGCTGCTTGAGGCCCGGGAAGCTGAAGGCAGCCTTGCCCGGGCGCTTTTCACGCCGGATAC
GCCGGAACCCGGGCCAGCTGATACAGACAGTCACGCCAGTGAACAACCTGAGCCGGTCAGCCCGCCTGCG
CCAGCAGTAATGACGGTAACTCCTGCACCGGTAAAATCGCCGCCGACAACAAAGCGTCCGGCAGCGGAGC
CTTCCGTCAGAGCAACGGAGCCTCCCGTCCTGCGGGGCACGACCGTACCGTTGATCAAACCAAAAGCAGC
CGCAGCGGCCACTGCTGCCTCAACAGCATCCTCTGCCGGTGCCCCTGCGGCAGCTGCAGGCGGGACAGAA
CAGGAACTGGCGCAGCAGTCAGCGGAACAGGGACAGGACATGCTGCCGGCCGGCATGAACGAGGACGGCG
TCATCGAGGACATGCAGGCGTATGACGCCTGGCTGGCAGATGAGCAGACACAGCGGGATATGCAGCGGCG
TGAAGAGGTCAATATCAACCACAGCCACCGCCACGATGAACAGGATGATGTCGAGATTGGGGGGAACTTC
TGA
 Primer design