SecReT4
Protein ID: 294496803
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p119
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]106905..112166 [+]
ProductoriT nicking-unwinding
Component typeTraI_F
UniProt IDD5KTU1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.1e-84, Aligned region: 7..288
TraI [PF07057], Evalue: 4.5e-56, Aligned region: 1433..1558
AAA_30 [PF13604], Evalue: 2.4e-43, Aligned region: 971..1158
UvrD_C_2 [PF13538], Evalue: 1.2e-05, Aligned region: 1340..1443
Protein Sequence: 1753 a.a.     [Download]
>gi|294496803|ref|YP_003560496.1| oriT nicking-unwinding [Klebsiella pneumoniae]
MMSIGSVKSAGSAGNYYTDKDNYYVIGSMDERWQGKGAEALGIDGKAVDKALFTELLKGKLPDGSDLTRI
QDGANKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVTEAVRQLETLAATRVMTDGKSETVLTGNL
IVAKFNHDTNRNQEPQIHTHAVVINATQNGDKWQSLGTDKIGKTGFIENVYANQIAFGKLYREAFKPLVE
KLGYETEVVGKHGMWEMKGVPVEPFSTRSQEVREAAGPDASLKSRDVAALDTRKSKEAIDPAEKMVEWMN
TLKETGFDIRGYREAADARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQFTYADLLARTVGQLE
AKDGMFELARKGIDAAIEREQLIPLDREKGLFTSNIHVLDELAVKALSQEVQRHNHVSVTPDASVVRQVP
FSDAVSVLAQDRPVMGIVSGQGGASGQRERVAELTLMAREQGRDVHILAADNRSRDFLAGDVRLAGETVT
GKSALQDGTAFIPGGTLIVDQAEKLSLKETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTY
RWQGGHQTTADIISEPDKGARYSRLAQEFAVSVREGQKSVAQISGTREQSVLNGLIRDSLRQEGVLGEKD
TTITALTPVWLDSKSRGVRDYYREGMVMERWDPETRTHDRFVIDRVTASSNMLTLKDREGGRLDLKVSAV
DSQWTLFRAETLPVAEGERLAVLGKIPDTRLKGGESITVMKVEEGQLTVQRPGQKTTQTLAVGAGVFDGI
KIGHGWVESPGRSVSETATVFASVTQRELDNATLNQLAQSGSHLRLYSAQDAARTTEKLSRHTSFSVVSE
QLKTRSGETDLDAAIAQQKAGLRTPAEQAIHLAIPLLESEKLTFSRPQLLATALETGGGKVPMADIDTTI
QTQIRSGQLLNAPVAHGYGNDLLISRQTWDAEKSILTHVLEGKGAVAPLMDRVPASLMTDLTAGQRAATR
MILESTDRFTVVQGYAGVGKTTQFRAVMSAISLLPEETRPRVIGLAPTHRAVGEMQSAGVEARTTASFLH
DTQLLQRNGQTPDFSNTLFLLDESSMVGLADMAKAHSLIVAGGGRAVSSGDNDQLQPIAPGQPFRLMQQR
SAADVAIMKEIVRQVPELRPAVYSLIERDVHRALTTIEQVTPEQVPRKEGVWAPGSSVVEFTQAQEKAIQ
KALSEGETLPAGQPASLYEALVKDYTGRTPEAQSQTLVITHLNKDRRALNSLIHDARRENGETGKEEITL
PVLVTSNIRDGELRKLSTWTAHKEAVALVDNVYHRISKVDKDNQLITLTDSEGKERFISPREASAEGVTL
YRQEKITVSQGDRMRFSKSDPERGYVANSIWEVQSVSGDSVTLSDGKLTRTLTPKADQAQQHIDLAYAIT
AHGAQGASEPYAIALEGVAGGREQMASFESAYVALSRMKQHVQVYTDSREGWIKAIQHSPEKATAHDILE
PRNDRAVKSADLLFGRARPLDETAAGRAALQQSGLAQGSSPGKFISPGKKYPQPHVALPAFDKNGKAAGI
WLSPLTDRDGRLEAIGGEGRIMGNEDARFVALQNSRNGESLLAGNMGEGVRMARDNPDTGVVVRLAGDDR
PWNPGAMTGGRVWAEPAPVAPVPQAGADIILPPEVLAQRAAEEQQRREMEKQAEQTAREVAGEARKAGEP
ADRVKEVIGDVIRGLERDRPGTEKTTLPDDPQFRRQEAAIQQVASESLQRERLQAVERDMVRDLNREKTL
GGD
 
Nucleotide Sequence: 5262 bp     [Download]
>gi|294496685|ref|NC_014016.1|:106905-112166 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGATGTCGATTGGCTCCGTTAAATCGGCGGGCAGTGCCGGTAATTACTATACGGATAAGGATAATTACT
ACGTCATAGGGAGCATGGACGAACGCTGGCAGGGTAAGGGGGCTGAGGCGCTGGGGATCGACGGGAAAGC
CGTGGATAAGGCGCTGTTTACGGAACTGCTGAAAGGGAAGCTGCCGGATGGCAGCGACCTGACCCGAATA
CAGGACGGCGCCAACAAGCACCGGCCCGGTTATGACCTGACCTTCTCGGCCCCCAAAAGCGTGTCGGTCA
TGGCGATGCTGGGCGGCGATAAACGCCTTATCGATGCCCACAACCAGGCGGTAACCGAAGCGGTGCGGCA
ACTGGAGACGCTGGCCGCGACCCGGGTCATGACGGACGGTAAAAGCGAAACGGTGCTGACCGGAAATCTG
ATTGTGGCGAAATTCAACCACGACACGAACCGTAACCAGGAACCTCAGATACACACCCATGCCGTCGTCA
TTAACGCCACGCAGAACGGGGACAAATGGCAGTCTCTCGGCACAGATAAGATCGGTAAAACAGGTTTTAT
CGAGAACGTGTACGCGAACCAGATAGCGTTCGGGAAGCTTTACCGGGAGGCGTTCAAACCCCTGGTTGAG
AAGCTTGGCTATGAGACGGAAGTTGTGGGCAAACACGGGATGTGGGAGATGAAAGGGGTCCCTGTGGAAC
CGTTCTCCACCCGGTCTCAGGAGGTCAGGGAGGCCGCAGGGCCCGATGCCTCCCTGAAGTCACGGGATGT
GGCCGCGCTCGATACCCGCAAGTCGAAAGAAGCCATCGATCCGGCAGAGAAGATGGTGGAGTGGATGAAC
ACGCTGAAGGAGACCGGGTTTGACATCCGGGGGTACCGTGAGGCCGCCGATGCGCGAGCCGCAGAGCTGG
CCCGTGCACCTGCCGCGCCGGTGAACACTGACGGTCCGGATATCACGGATGTGGTGACGAAAGCGATTGC
CGGTCTCAGCGACCGCAAGGTGCAGTTCACGTATGCCGACCTGCTGGCACGCACGGTCGGCCAGCTGGAG
GCGAAGGACGGTATGTTTGAGCTGGCGAGAAAGGGCATCGATGCCGCCATTGAACGGGAGCAGCTTATCC
CTCTCGATCGCGAGAAAGGCCTGTTCACCTCAAACATCCACGTTCTCGATGAACTCGCCGTCAAAGCCCT
GAGTCAGGAGGTGCAGCGCCATAATCATGTCTCAGTCACGCCTGATGCGTCTGTGGTGCGCCAGGTCCCT
TTCAGCGATGCCGTCAGCGTGCTGGCGCAGGATCGCCCGGTAATGGGTATCGTTTCCGGTCAGGGCGGTG
CAAGCGGCCAGCGGGAGCGGGTGGCCGAGTTAACCCTGATGGCCCGGGAGCAGGGGCGTGACGTCCATAT
CCTGGCGGCCGATAACCGCTCACGTGATTTTCTCGCCGGTGATGTGCGTCTGGCCGGGGAAACGGTGACC
GGTAAATCCGCCCTGCAGGACGGGACGGCGTTTATTCCGGGCGGAACACTCATCGTGGATCAGGCGGAGA
AGCTGAGCCTGAAGGAAACGATTTCCCTGCTCGATGGCGCGATGCGCCATAACGTGCAGGTCCTGCTCTC
CGACAGCGGGAAGCGCAGCGGGACCGGCAGCGCGCTGACGGTGCTGAAGGACAGCGGCGTGAATACGTAT
CGCTGGCAGGGTGGCCATCAGACCACAGCCGACATCATCAGTGAACCGGATAAAGGAGCACGCTACAGCC
GGCTGGCACAGGAGTTTGCCGTCAGCGTGCGTGAAGGGCAGAAAAGCGTGGCCCAAATCAGCGGGACCCG
TGAACAGAGCGTACTCAACGGCCTCATCCGTGACTCCCTCAGACAGGAGGGGGTGCTGGGTGAGAAAGAC
ACGACTATTACAGCCCTGACGCCGGTGTGGCTGGACAGCAAAAGCCGGGGCGTGCGGGATTATTACCGGG
AGGGGATGGTGATGGAACGCTGGGATCCGGAGACCCGGACGCACGATCGCTTTGTCATTGACCGGGTGAC
CGCGAGCAGCAATATGCTGACCCTGAAAGACCGGGAAGGGGGCCGTCTGGATCTGAAGGTTTCCGCGGTC
GACAGCCAGTGGACGCTGTTCCGGGCAGAAACACTGCCGGTGGCAGAGGGGGAACGTCTGGCGGTGCTCG
GGAAGATACCGGACACACGCCTGAAAGGCGGGGAAAGCATCACGGTGATGAAAGTGGAGGAGGGGCAGCT
GACGGTACAGCGGCCGGGGCAGAAAACCACGCAGACCCTGGCCGTGGGCGCGGGCGTGTTTGACGGTATT
AAAATCGGCCACGGCTGGGTGGAAAGTCCCGGCAGGTCGGTTAGCGAGACGGCAACGGTCTTTGCGTCGG
TGACGCAGCGTGAGCTGGATAACGCCACCCTCAACCAGCTGGCGCAGAGCGGAAGTCATCTCCGGCTGTA
CTCGGCGCAGGATGCGGCGCGCACGACGGAGAAGCTGTCGCGGCATACCTCCTTCAGCGTGGTCTCAGAG
CAGCTGAAGACCCGATCCGGCGAGACGGACCTGGATGCGGCCATTGCGCAGCAGAAGGCCGGACTGCGTA
CCCCGGCAGAACAGGCCATTCACCTGGCCATCCCGCTGCTTGAAAGTGAGAAACTGACCTTCTCCCGGCC
CCAGCTGCTGGCGACGGCGCTGGAAACCGGGGGCGGGAAGGTTCCGATGGCGGACATCGACACGACCATT
CAGACACAAATCAGGTCGGGGCAGTTGCTGAATGCACCGGTGGCGCACGGCTACGGCAATGACCTGCTGA
TTTCCCGTCAGACCTGGGACGCCGAAAAAAGCATCCTGACCCACGTGCTGGAAGGTAAAGGCGCGGTGGC
CCCCCTGATGGACCGCGTGCCGGCCAGTCTGATGACGGACCTGACCGCCGGACAGCGGGCGGCGACCCGG
ATGATTCTGGAAAGCACGGATCGGTTCACGGTGGTTCAGGGGTATGCCGGGGTGGGGAAAACCACCCAGT
TCCGGGCAGTCATGAGTGCCATCAGTCTGCTGCCGGAAGAGACCCGTCCGCGCGTCATCGGTCTGGCGCC
GACGCATCGCGCGGTCGGGGAAATGCAGAGTGCCGGCGTGGAGGCGCGCACGACGGCGTCGTTCCTCCAC
GACACGCAGCTGCTGCAGCGCAATGGCCAGACACCCGATTTCAGCAACACCCTGTTTCTGCTCGACGAGA
GCTCGATGGTGGGGCTGGCCGATATGGCAAAAGCCCACTCCCTCATCGTCGCCGGCGGTGGACGGGCGGT
GTCCAGTGGGGATAACGACCAGCTGCAGCCCATCGCGCCGGGCCAGCCGTTCAGGCTGATGCAGCAGCGC
AGCGCCGCCGACGTTGCCATCATGAAAGAGATTGTGCGCCAGGTGCCTGAGCTGCGACCGGCGGTCTACA
GCCTGATTGAGCGGGATGTGCACCGCGCCCTGACCACCATTGAGCAGGTCACGCCGGAACAGGTGCCGAG
AAAAGAAGGCGTCTGGGCGCCGGGCAGTTCTGTGGTGGAATTCACGCAGGCACAGGAAAAGGCGATACAA
AAGGCACTGAGCGAGGGGGAAACCCTGCCGGCAGGTCAGCCCGCGTCGCTCTACGAGGCGCTGGTGAAGG
ACTATACCGGACGGACCCCGGAGGCACAGTCGCAGACGCTGGTGATCACCCATCTGAATAAGGACCGGCG
GGCGCTGAACAGTCTGATCCATGACGCACGGCGGGAGAACGGGGAAACCGGCAAAGAGGAAATCACCCTG
CCGGTGCTGGTCACGAGTAACATCCGTGACGGTGAACTGCGCAAATTGTCGACCTGGACGGCTCACAAGG
AGGCGGTGGCGCTGGTTGATAACGTATACCACCGTATCAGCAAAGTGGATAAGGATAATCAGTTGATCAC
TCTGACTGACAGTGAAGGAAAGGAGCGATTTATCTCACCCCGGGAGGCATCGGCAGAAGGCGTCACGCTC
TATCGTCAGGAAAAGATCACCGTGTCTCAGGGGGACCGAATGCGTTTCAGCAAAAGTGACCCGGAGCGCG
GCTATGTGGCCAACAGTATCTGGGAGGTGCAGTCTGTTTCGGGTGACAGTGTCACGCTGTCTGATGGCAA
ACTAACCCGCACGCTGACCCCGAAGGCGGATCAGGCGCAGCAGCATATCGACCTCGCCTACGCCATCACC
GCCCACGGCGCCCAGGGGGCCAGCGAACCGTATGCCATCGCGCTGGAAGGGGTGGCCGGTGGTCGGGAAC
AGATGGCCAGCTTTGAGTCTGCCTATGTGGCTTTATCTCGCATGAAACAGCATGTTCAGGTCTACACCGA
CAGCCGTGAGGGCTGGATAAAGGCCATCCAGCATTCACCTGAGAAAGCGACGGCGCACGATATTCTGGAA
CCCCGTAACGACCGGGCGGTGAAAAGCGCAGATCTGCTGTTCGGTCGGGCAAGGCCACTGGATGAAACCG
CCGCGGGCCGGGCAGCCCTGCAGCAGTCCGGTCTGGCACAGGGAAGTTCACCAGGAAAATTCATTTCTCC
GGGGAAAAAGTACCCTCAGCCGCATGTGGCGCTGCCGGCATTTGATAAAAACGGGAAAGCCGCCGGTATC
TGGCTCAGCCCACTGACCGATCGGGACGGACGGCTTGAGGCTATCGGCGGGGAGGGACGAATTATGGGCA
ATGAAGACGCCCGGTTCGTGGCGCTGCAGAACAGCCGCAACGGTGAAAGCCTGCTGGCCGGGAATATGGG
GGAGGGCGTCAGAATGGCCCGCGACAATCCCGATACCGGGGTGGTGGTGCGTCTGGCCGGTGATGACCGC
CCCTGGAACCCCGGGGCCATGACCGGCGGGCGGGTATGGGCTGAACCGGCGCCGGTGGCTCCGGTACCGC
AGGCCGGGGCTGACATTATCCTCCCGCCAGAGGTTCTGGCGCAGCGGGCGGCAGAAGAACAGCAGCGCCG
GGAAATGGAAAAACAGGCGGAACAGACTGCCCGGGAAGTGGCCGGGGAGGCGCGTAAAGCCGGCGAGCCG
GCGGACCGGGTGAAAGAGGTTATCGGGGACGTCATTCGCGGACTGGAGCGTGACCGGCCGGGTACGGAGA
AAACGACGCTACCGGATGATCCTCAGTTCCGGCGCCAGGAGGCGGCGATTCAGCAGGTGGCCTCAGAAAG
TCTGCAGCGTGAACGTCTGCAGGCTGTGGAGCGGGACATGGTGCGCGACCTGAACCGCGAGAAAACCCTC
GGGGGCGACTGA
 Primer design