SecReT4
Protein ID: 294496804
T4SS name [ID]Tra_F [83]
Gene symbol-
Locus tagpKpQIL_p120
StrainKlebsiella pneumoniae plasmid pKpQIL (NC_014016)
Repliconplasmid pKpQIL [GenBank: NC_014016] [Browse all T4SS(s) in this replicon]
Location [Strand]112247..112972 [+]
ProductF pilin acetylation protein
Component typeTraX_F
UniProt IDD5KTU2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.1e-51, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|294496804|ref|YP_003560497.1| F pilin acetylation protein [Klebsiella pneumoniae]
MRAQHTFPGATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNSLWGWALVAQVSFMLIGYPWYSGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVI
WIPLSTASYGMAGVGMLAASWLLCRAQHAPERLVYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
SGERVKRFWPRHFFAMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|294496685|ref|NC_014016.1|:112247-112972 Klebsiella pneumoniae plasmid pKpQIL, complete sequence
ATGAGAGCACAACACACATTTCCAGGCGCGACAGACAGCTGGCTTCAGCGCCTGCTGACCTGGACACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACGGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGGGGTTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AACCTGGCCCGGCACGCGGAAATACGCCAGTCGCAGCTGAACAGCCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTTATTGGATACCCGTGGTATTCCGGGAATATTCTGTTTGCCTTTGCCGTCACGGG
CCAGGTCCTGCGGTGGGTCAGTCAGCCGTCCTGGTATTACACCCTCCCGGCGGCTGGACTACTGGTCATC
TGGATACCCCTGTCGACCGCCAGCTACGGCATGGCCGGAGTGGGCATGCTCGCCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACCGGAACGGCTGGTGTACGGGGTGCTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGGCTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
TCCGGAGAACGTGTGAAACGTTTCTGGCCGCGGCATTTCTTCGCAATGTTCTATGCTGTGCACCTGGCGG
TACTGGGTATTGTCGTCTCAATGTGA
 Primer design