SecReT4
Protein ID: 294502413
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0303
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]358410..359042 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDD5AZG6
KEGG IDypz:YPZ3_0303
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|294502413|ref|YP_003566475.1| hypothetical protein YPZ3_0303 [Yersinia pestis Z176003]
MKKTLVVSALAAVILTGCTTQQPLQQRDASLVTPSVTVTRNVQPVSPDAYGQAPEVVRYDRYLLVSTDPA
AAQRDPLSQIIDIRIPASVKPTVADALRYALRQSGYSLCATGPANGVLYRQALPAVQYQLGPMRLRTALQ
VLAGPAWQLEVDDVQRVVCHSLRDGYQLPATQLPPVAVAPARAVSAGPAATVIAPQAVNAVPATGGWLKK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|294502110|ref|NC_014029.1|:358410-359042 Yersinia pestis Z176003 chromosome, complete genome
ATGAAAAAAACACTTGTAGTCTCCGCCCTGGCAGCCGTCATCCTGACGGGCTGCACCACGCAACAACCCC
TGCAGCAGCGTGATGCGTCACTGGTCACACCGTCTGTCACCGTCACCCGCAATGTCCAGCCCGTTTCCCC
GGATGCGTATGGTCAGGCGCCGGAAGTCGTGCGCTATGACCGTTATCTGCTGGTCAGCACCGATCCGGCC
GCTGCCCAGCGTGATCCGCTTTCGCAAATCATCGATATCCGTATTCCGGCGTCAGTAAAACCGACGGTTG
CTGATGCGTTGCGTTATGCGCTGCGCCAGTCGGGCTATTCCCTGTGCGCGACCGGACCGGCAAACGGCGT
GTTGTACCGCCAGGCGTTGCCGGCGGTGCAGTACCAACTGGGGCCGATGCGTTTGCGTACCGCGCTGCAG
GTACTGGCAGGCCCCGCGTGGCAGCTCGAGGTAGACGACGTGCAACGTGTTGTCTGCCATAGCCTGCGCG
ACGGGTATCAGTTGCCGGCGACACAGCTGCCGCCGGTGGCGGTGGCGCCAGCCAGGGCGGTTTCAGCAGG
TCCTGCTGCGACGGTCATTGCACCTCAAGCCGTTAACGCGGTACCGGCAACCGGCGGGTGGTTGAAAAAA
TGA
 Primer design