SecReT4
Protein ID: 294502416
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0306
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]360482..361174 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDD5AZG9
KEGG IDypz:YPZ3_0306
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 230 a.a.     [Download]
>gi|294502416|ref|YP_003566478.1| hypothetical protein YPZ3_0306 [Yersinia pestis Z176003]
MDTRRILTRGLLPLFALLTVVSGSVVHAATQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIISVT
RGAGPAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWAA
FDPYTNLNAAAAILRECYDRNPGSWLVAAGCYHHPAGGAPAARYKSIVSGKLARLNGRGAAPVRVTSTTP
TPTALPAQTAALIWIEPRSQ
 
Nucleotide Sequence: 693 bp     [Download]
>gi|294502110|ref|NC_014029.1|:360482-361174 Yersinia pestis Z176003 chromosome, complete genome
ATGGACACTCGCCGCATTCTGACCCGGGGGCTGTTGCCCCTGTTTGCTCTCCTTACTGTTGTGAGCGGTA
GTGTCGTACATGCTGCCACCCAGCAGGTTCCTTCCGGCTACCGGGAGGTAGCGCTGCGCCACGGGGTGCC
GCCGGAGTCCCTGTACTCGGTGGCGCTGGCCGAGACTTCGATGGCGCCGAAAAGCATCATCTCGGTAACC
CGCGGGGCCGGCCCGGCCCCGGATGTGGAACGCCCCTGGCCCTGGACTATTAACGTGGCCGGCAAAGGGT
ATCGTTACGCCAGCCGCCTGCAGGCCTGGGAAGCACTGCAGCGCTTTTTGAAAACACATCCTCGCAAGCG
CATCGATGTCGGGATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTCACGTCGACCTGGGCGGCG
TTTGACCCTTACACCAATCTCAACGCGGCGGCGGCTATCCTGCGGGAATGCTATGACCGCAACCCTGGGA
GCTGGCTGGTTGCCGCTGGGTGTTATCACCATCCCGCCGGCGGCGCCCCTGCAGCCCGGTATAAATCCAT
CGTGAGCGGCAAGCTGGCACGCCTGAACGGCAGGGGGGCGGCCCCGGTCCGGGTGACCAGTACAACCCCC
ACGCCCACGGCTTTACCGGCACAAACGGCGGCGCTGATCTGGATTGAACCACGGAGTCAATAA
 Primer design