SecReT4
Protein ID: 294502421
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0311
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]365028..365684 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDD5AZH4
KEGG IDypz:YPZ3_0311
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.1e-73, Aligned region: 15..215
Protein Sequence: 218 a.a.     [Download]
>gi|294502421|ref|YP_003566483.1| hypothetical protein YPZ3_0311 [Yersinia pestis Z176003]
MFFASLFVSLVIEYVGMAFFWPELGASHSEAVMNTELGYLSSEFTRSLLLSEPSVTVTRWIMMAYQWTFV
DSGFLDWIQRAYDTQVHSQNAVARELNSWSGWLAATLKEYLVATVYVTVITLVRTTILVLSIPLFVLVVL
VALTEGLGRRDVRRYGAGYESSFVYHHAKRMVKPAVYIPCMLYLSWPTAVYPNLLLLPAAILLGVAVTVT
TASFKKYL
 
Nucleotide Sequence: 657 bp     [Download]
>gi|294502110|ref|NC_014029.1|:365028-365684 Yersinia pestis Z176003 chromosome, complete genome
ATGTTTTTTGCCTCGTTGTTTGTGAGCCTGGTGATTGAATATGTCGGGATGGCCTTCTTCTGGCCAGAGC
TGGGTGCGTCGCACAGTGAAGCCGTGATGAACACCGAGTTGGGGTACCTGTCATCGGAGTTTACGCGCAG
CTTGCTGCTGTCTGAACCTTCGGTGACTGTCACCCGCTGGATTATGATGGCGTATCAATGGACCTTCGTG
GACAGCGGCTTTTTGGACTGGATCCAACGTGCGTATGACACGCAGGTGCACAGCCAGAATGCCGTGGCCA
GGGAGCTGAACAGTTGGAGTGGTTGGTTGGCCGCCACGCTCAAAGAGTACCTGGTGGCGACGGTCTATGT
CACCGTCATCACCCTGGTGCGGACGACTATTTTGGTGCTATCTATCCCGCTGTTTGTCCTGGTGGTGTTA
GTCGCGTTGACGGAAGGCCTGGGGCGGCGTGATGTTCGGCGTTATGGCGCTGGCTATGAATCGAGCTTTG
TCTACCATCATGCTAAACGCATGGTAAAGCCGGCAGTGTACATTCCCTGCATGCTGTATCTGTCCTGGCC
AACCGCGGTATACCCCAATTTGTTGCTGTTGCCAGCGGCTATTTTGCTCGGTGTTGCGGTGACAGTGACC
ACAGCCTCCTTCAAAAAATACCTGTAG
 Primer design