SecReT4
Protein ID: 294502422
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0312
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]365919..366248 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD5AZH5
KEGG IDypz:YPZ3_0312
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.2e-30, Aligned region: 22..104
Protein Sequence: 109 a.a.     [Download]
>gi|294502422|ref|YP_003566484.1| hypothetical protein YPZ3_0312 [Yersinia pestis Z176003]
MTISVVRGLGAGCLLGLTLLTALPAQAAEKDELASAQRMLIQVQAALERARVAAVQADPSERGRFFFDYA
RATADLKTINAGIDRYLEPSRAQPRGGSAVAGNYRRERP
 
Nucleotide Sequence: 330 bp     [Download]
>gi|294502110|ref|NC_014029.1|:365919-366248 Yersinia pestis Z176003 chromosome, complete genome
ATGACTATCTCCGTTGTTCGCGGTCTCGGTGCCGGCTGTTTGCTGGGACTGACTCTGCTGACCGCACTGC
CTGCCCAGGCTGCTGAAAAAGATGAGCTGGCGTCTGCCCAGCGCATGTTGATTCAGGTGCAGGCGGCGCT
TGAACGTGCACGCGTTGCCGCCGTTCAGGCTGACCCGTCTGAGCGTGGCCGTTTCTTCTTTGACTATGCC
CGCGCCACTGCCGACCTCAAGACCATCAATGCCGGTATTGACCGCTACCTCGAGCCTTCACGCGCGCAAC
CCCGTGGTGGCAGCGCCGTGGCTGGCAACTACCGGCGGGAGCGTCCCTGA
 Primer design