SecReT4
Protein ID: 294502424
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0314
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]366936..367301 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDD5AZH7
KEGG IDypz:YPZ3_0314
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.2e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|294502424|ref|YP_003566486.1| hypothetical protein YPZ3_0314 [Yersinia pestis Z176003]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRLKRGKPENYIWQRLEARKRRMGWGDPTLIIDKQGWSLRRSRVVKRSQ
 
Nucleotide Sequence: 366 bp     [Download]
>gi|294502110|ref|NC_014029.1|:366936-367301 Yersinia pestis Z176003 chromosome, complete genome
ATGCAGACTATCCGTTTTTTGCCTGATCGCCTTAACGCCGAACCTGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGGTTGGCGGCGTTGGCGGGCGTAGGGCTGGGTCTGCTCGTGTCGTTGCCGTTTTTTCCCCT
TGCCGGCTGGGTCGTGATACCCACCGGCATGCTGGTGACACCCCTCCTCGTCATCTGGTTTGGTGGCAGC
CGGCTGACGCGCCTCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCGCGTAAACGTC
GTATGGGGTGGGGTGATCCCACCCTGATTATAGACAAACAGGGCTGGTCGTTGCGTCGCAGCCGCGTTGT
AAAGAGGTCCCAATGA
 Primer design