SecReT4
Protein ID: 294502433
T4SS name [ID]Tfc [719]
Gene symbol-
Locus tagYPZ3_0323
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T4SS(s) in this replicon]
Location [Strand]379964..381445 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDD5AZI6
KEGG IDypz:YPZ3_0323
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 493 a.a.     [Download]
>gi|294502433|ref|YP_003566495.1| hypothetical protein YPZ3_0323 [Yersinia pestis Z176003]
MNNTMNKSLWGRRSLLSLLIAGSLMLAGVNAHADDNDDNGTLFGISLPQVNDSNVGYGKSASGAVSDKLF
YSLGGGSVISQPATRGNMQRLGMNLGWSSDLMCGNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVGS
LPAMAIQRANPGLYEMLTNGVLQGGVAFDKAQLNCQNLSKRMMDMADSGGWSQAAAMEEAKSLINNGDAD
AVRSMNATEKVTGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNALPVTSTSSVSGSSCTGGACAK
YASSEEAAAAVVKVLGDSSLRTCKDAAQCTSGEGSEQPGSTVAGTGFAPMLEEATKENNEQLAKLVNGAE
KPTAANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTIETAFIMRRMVTTGMSEPNAAVQ
KMAMEEGDRRIEALDREITALKNEMEMKREISRNAVLTIIDRENNRAETNPQRQSVDSPDTKFNQLAVPE
SDQ
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|294502110|ref|NC_014029.1|:379964-381445 Yersinia pestis Z176003 chromosome, complete genome
ATGAATAACACAATGAATAAATCTCTTTGGGGACGGCGCAGCCTGCTTTCTCTGCTGATTGCCGGCAGCC
TGATGCTGGCCGGCGTGAACGCGCACGCTGACGACAATGACGATAACGGCACCCTGTTTGGTATTTCGTT
GCCCCAGGTGAATGACAGCAACGTGGGGTACGGGAAGAGCGCCAGCGGCGCGGTCTCGGACAAGCTGTTT
TACTCCCTGGGCGGCGGCTCGGTGATTTCGCAGCCGGCGACGCGCGGCAACATGCAGCGGCTGGGTATGA
ACCTGGGCTGGAGCTCGGATTTGATGTGCGGCAACTTTGATCTGAAGACCACCATTGGCAACCAGCTCAA
CGGGGTGACGGACGGCTTCAAGAACCTGATGGGCAGTGTTATCCAGGGCGCCACCGGTGCGGTGGGCAGC
CTGCCGGCGATGGCTATCCAGCGCGCCAATCCGGGACTGTATGAAATGCTGACCAACGGGGTGCTGCAGG
GCGGTGTCGCGTTCGATAAGGCGCAACTGAACTGTCAGAACCTCTCCAAGCGGATGATGGATATGGCGGA
CTCCGGCGGCTGGAGCCAGGCCGCCGCGATGGAGGAAGCCAAGAGCCTGATCAATAACGGGGATGCCGAT
GCGGTGCGGTCGATGAATGCCACGGAGAAAGTGACTGGACAATCCGGCCAGACCTGGATCGGTGGTCAGA
AGCGGGGTGGAGCCGGCCAGCCGGCCATCAAGCCCACGCATGACCTGGCGGCCGCCGGCTATAACATGAT
GAATGCGCTGCCGGTCACCAGTACCTCCAGCGTATCCGGCAGCAGCTGCACCGGTGGTGCCTGTGCCAAA
TATGCCAGCAGTGAAGAAGCGGCAGCTGCCGTGGTGAAGGTGTTGGGGGATTCCTCCCTGCGCACCTGTA
AAGATGCGGCACAATGCACCAGCGGGGAAGGCAGCGAACAGCCAGGCAGTACTGTGGCCGGCACCGGCTT
TGCCCCGATGCTGGAAGAGGCGACGAAGGAGAATAACGAGCAGTTGGCCAAACTGGTCAACGGGGCAGAG
AAACCCACCGCGGCCAACCTGGCCAAACTCAAAACGGGCAGCCTGGCGGTGACAGCCGGCGTCATCAAGG
CACTGCAGCGCGACCCGGATAATGCTGCTCTGGTCGGCCGCCTGGCCAGTGAACTGGCGATGGCTGACAC
CATTGAAACGGCCTTTATCATGCGCCGTATGGTCACCACCGGCATGTCAGAGCCCAATGCCGCAGTCCAG
AAAATGGCGATGGAAGAGGGCGATCGGCGTATCGAAGCGCTGGACCGCGAAATCACGGCGCTGAAAAACG
AGATGGAGATGAAACGCGAGATTTCCCGTAACGCGGTGCTGACCATCATCGATCGCGAGAACAACCGTGC
GGAAACCAACCCGCAGCGTCAGTCGGTTGACAGCCCGGACACCAAGTTCAACCAGCTGGCCGTACCGGAA
AGCGACCAGTAA
 Primer design