SecReT4
Protein ID: 295689875
T4SS name [ID]Trb [788]
Gene symbol-
Locus tagCseg_2495
StrainCaulobacter segnis ATCC 21756
Repliconchromosome [GenBank: NC_014100] [Browse all T4SS(s) in this replicon]
Location [Strand]2729124..2729903 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDD5VKC7
KEGG IDcse:Cseg_2495
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-55, Aligned region: 36..249
Protein Sequence: 259 a.a.     [Download]
>gi|295689875|ref|YP_003593568.1| P-type conjugative transfer protein TrbG [Caulobacter segnis ATCC 21756]
MSGLVARAGLAWALMSSSVLADPGGDPRLAAPAGMSAYLWAEDAVYPLIATPGRISDIVLEPGERLVGEG
AIAAGDTARWIIGDTVSGAGEARRVHVLVKPTEVGLATNLLINTDRRAYHLELRASDRTWQARVSWRYPQ
RATPVLVAAPPARPGLDLSRVNRAYRIEGDHPAWRPVAVFDDGQRAYIEFGPGVTLDDLPPLYRLSQDGK
ASELVNYRVEGRRIVLDRLFDRVELRLGIKRQARRVVIVRVAGAIEARR
 
Nucleotide Sequence: 780 bp     [Download]
>gi|295687459|ref|NC_014100.1|:c2729903-2729124 Caulobacter segnis ATCC 21756 chromosome, complete genome
ATGAGCGGCCTTGTCGCCCGCGCGGGCCTGGCCTGGGCCCTGATGTCCTCCAGCGTCTTGGCTGACCCCG
GGGGCGATCCTCGTCTGGCCGCGCCGGCCGGGATGAGCGCCTATCTCTGGGCCGAGGACGCCGTCTATCC
GCTGATCGCCACGCCGGGCCGCATCAGCGACATCGTGCTCGAGCCCGGCGAGCGTCTGGTGGGGGAAGGG
GCCATCGCGGCGGGCGACACCGCCCGCTGGATCATCGGCGATACGGTGAGCGGCGCGGGCGAGGCGCGGC
GGGTCCACGTGCTGGTCAAGCCGACAGAGGTCGGGCTGGCGACCAACCTGCTGATCAACACCGACCGGCG
CGCCTACCATCTGGAGCTTCGCGCCTCGGACCGGACCTGGCAGGCGCGGGTCTCGTGGCGCTATCCGCAA
AGGGCGACGCCGGTTCTGGTGGCCGCGCCGCCGGCCAGGCCGGGCCTTGATCTCTCGCGCGTCAACCGAG
CCTACCGGATCGAGGGGGATCATCCGGCCTGGCGGCCGGTCGCCGTGTTCGACGACGGCCAGCGGGCCTA
TATCGAGTTTGGCCCCGGCGTCACGCTGGACGACCTGCCGCCGCTCTATCGGCTGAGCCAGGACGGCAAG
GCCAGCGAGCTCGTCAACTACCGCGTCGAGGGGCGGCGGATCGTGCTCGATCGCCTGTTCGACCGGGTCG
AGCTGCGCTTGGGGATCAAGCGTCAGGCCCGGCGGGTGGTGATCGTGCGTGTCGCCGGCGCGATCGAGGC
TCGGCGATGA
 Primer design