SecReT4
Protein ID: 295689877
T4SS name [ID]Trb [788]
Gene symbol-
Locus tagCseg_2497
StrainCaulobacter segnis ATCC 21756
Repliconchromosome [GenBank: NC_014100] [Browse all T4SS(s) in this replicon]
Location [Strand]2730583..2731827 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDD5VKC9
KEGG IDcse:Cseg_2497
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1e-45, Aligned region: 38..261
Protein Sequence: 414 a.a.     [Download]
>gi|295689877|ref|YP_003593570.1| P-type conjugative transfer protein TrbL [Caulobacter segnis ATCC 21756]
MSDVGVIDRFFDTFNRYLDSGFGLLGGEVAFLSTTLVAIDVTLAALFWAWASSEDVLARLIKKTLYVGFF
AFLIGNFQSLSFIVLKSFSGLGLKASGAGVSAEDFLRPGRLAALGVTSCKPLLEAAAELGGFPGFFENIV
QIVVLLLVALFVIVAFFIIAVQVFVVLIEFKLVTLAGFVLVPFGLFGRTAFLAEKVLGNVIASGVKVMVL
AIVVGIGASLFSEFTREAGGQPTLEEVLAMALAALTLLGLSIFGPGVASGLVSGAPHLGAGAAVGTGLVV
GGMAMAGAAAAQMAAGGLSGAGAAAAAGAGRAPPAGPAPSGGGPSHPPPGDGGAGAAASRGQASPSSAGP
SGQGGASGPAAPGKPEDPSAQPAWARELEHRQALTHGAAMAVHAAGSGDDPGAGAAPSLSEDRG
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|295687459|ref|NC_014100.1|:c2731827-2730583 Caulobacter segnis ATCC 21756 chromosome, complete genome
ATGAGCGACGTCGGCGTCATCGATCGCTTCTTCGACACCTTCAACCGCTATCTCGACAGCGGCTTTGGCC
TCTTGGGCGGGGAGGTGGCGTTTCTCTCCACCACCCTGGTGGCCATCGACGTCACCTTGGCCGCGCTGTT
TTGGGCCTGGGCCTCGAGCGAGGACGTCCTGGCCCGGCTGATCAAGAAGACCCTCTATGTCGGGTTCTTC
GCCTTCCTGATCGGCAACTTCCAGAGCCTGTCCTTTATCGTGCTGAAGAGCTTTTCGGGGCTTGGCCTCA
AGGCCTCGGGGGCGGGGGTCTCGGCCGAGGATTTCCTGCGGCCCGGAAGGCTGGCGGCGCTGGGCGTGAC
GTCCTGCAAGCCGCTCTTGGAGGCGGCCGCCGAGCTGGGCGGCTTTCCAGGCTTCTTCGAGAACATCGTC
CAGATCGTCGTCCTGCTCCTGGTGGCGCTCTTCGTGATCGTCGCCTTCTTCATTATCGCCGTGCAGGTCT
TCGTGGTTTTGATCGAGTTCAAGCTCGTCACCCTGGCCGGCTTCGTCCTCGTGCCGTTCGGTCTCTTTGG
CCGCACCGCCTTCCTGGCCGAGAAGGTGCTGGGCAATGTCATCGCCAGTGGCGTCAAGGTCATGGTGCTG
GCCATCGTCGTCGGCATCGGCGCGTCGCTGTTCTCCGAATTCACTCGCGAGGCCGGCGGCCAACCGACCC
TAGAAGAGGTGCTGGCCATGGCCCTGGCCGCCCTGACCTTGCTGGGGCTTTCGATCTTTGGGCCCGGCGT
GGCCTCGGGCCTGGTGTCGGGCGCGCCGCACCTGGGGGCCGGGGCCGCGGTCGGCACGGGCCTGGTGGTC
GGCGGCATGGCCATGGCCGGCGCGGCGGCCGCCCAGATGGCCGCCGGCGGTCTCTCGGGGGCCGGGGCCG
CCGCGGCGGCGGGCGCTGGACGCGCGCCGCCGGCGGGGCCCGCGCCGTCGGGCGGCGGGCCGTCTCATCC
CCCGCCCGGGGATGGCGGGGCCGGCGCCGCCGCGTCGCGCGGCCAAGCTTCGCCGTCGAGCGCCGGTCCG
AGCGGCCAGGGCGGCGCAAGCGGACCCGCCGCGCCGGGCAAGCCGGAGGATCCGTCGGCCCAGCCGGCCT
GGGCCCGGGAGCTCGAACACCGCCAAGCCCTGACCCATGGCGCGGCCATGGCCGTCCACGCCGCCGGCAG
CGGCGATGACCCCGGCGCGGGCGCCGCGCCCAGCCTTTCGGAGGATCGAGGATGA
 Primer design