SecReT4
Protein ID: 295689882
T4SS name [ID]Trb [788]
Gene symbol-
Locus tagCseg_2502
StrainCaulobacter segnis ATCC 21756
Repliconchromosome [GenBank: NC_014100] [Browse all T4SS(s) in this replicon]
Location [Strand]2735463..2735828 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDD5VKD4
KEGG IDcse:Cseg_2502
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.2e-22, Aligned region: 28..111
Protein Sequence: 121 a.a.     [Download]
>gi|295689882|ref|YP_003593575.1| conjugal transfer protein TrbC [Caulobacter segnis ATCC 21756]
MPKTSSYRARLLAGFLRDRLGHLGRLGALGLAAALAGSGARAAGSSMPWEEPLQRILDSVEGPVAKIIAV
IIIIVTGLTLAFGETSGGSRKLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 366 bp     [Download]
>gi|295687459|ref|NC_014100.1|:c2735828-2735463 Caulobacter segnis ATCC 21756 chromosome, complete genome
ATGCCCAAAACCTCATCCTATCGCGCTCGCCTCCTGGCCGGCTTCCTGCGCGACCGGCTCGGTCATCTTG
GCCGCCTCGGCGCCCTGGGCCTGGCCGCCGCCCTGGCCGGCTCGGGCGCGCGGGCGGCCGGCTCGTCCAT
GCCCTGGGAGGAGCCGCTGCAGCGCATCCTCGACTCCGTCGAAGGGCCGGTGGCCAAGATCATCGCGGTG
ATCATCATCATCGTCACGGGCCTCACCCTAGCCTTCGGCGAGACCTCCGGCGGCTCGCGCAAGCTGATCC
AGATCGTCTTTGGCCTGTCGATCGCCTTCGCCGCCAGCTCGTTCTTCCTGTCGTTCTTTTCGTTCGGCGG
CGGAGCCCTGGTCTGA
 Primer design