SecReT4
Protein ID: 295697845
T4SS name [ID]Tra_F [115]
Gene symbol-
Locus tagECL_A006
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_A [GenBank: NC_014107] [Browse all T4SS(s) in this replicon]
Location [Strand]3511..4281 [-]
ProductTraX family protein
Component typeTraX_F
UniProt IDD5CK61
KEGG IDenc:ECL_A006
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 4.3e-49, Aligned region: 23..252
Protein Sequence: 256 a.a.     [Download]
>gi|295697845|ref|YP_003602502.1| TraX family protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MNHSLPDVLPTIRNASQLSPAALDMVKLLALLAMIIDHTNTVFLSSALPVMYALGRMAFPLFTLIWAMNV
QRTPERLQKRANRLWIWAVITQPVFSLAFQNQQPWWALNILFVFAGVTQLLALQYRHGRKGMLAGYLLLA
LMIWPLQPASYGLAGITLAISMATVSGSDTPGVQRLAAITAVLSLICLNGLSHLLDMPAETLLLATLPTL
AFPLAVVSFCRQICPEGRRRFMPRNFFYYAYAGHLGIIGLVQTTFG
 
Nucleotide Sequence: 771 bp     [Download]
>gi|295697839|ref|NC_014107.1|:c4281-3511 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence
ATGAATCATTCATTACCCGACGTTCTTCCCACTATCCGGAACGCCAGCCAGCTCAGTCCCGCTGCACTCG
ATATGGTCAAACTTCTCGCACTTCTGGCCATGATTATCGACCACACCAATACGGTGTTTCTGTCGTCAGC
ATTGCCGGTGATGTATGCGCTTGGCCGGATGGCCTTCCCCCTGTTCACGCTTATATGGGCGATGAACGTA
CAGCGCACCCCGGAGCGACTGCAGAAGAGAGCCAATCGTCTGTGGATCTGGGCAGTCATAACGCAGCCGG
TGTTCAGCCTGGCCTTCCAGAATCAACAGCCCTGGTGGGCCCTGAACATTCTGTTCGTGTTTGCAGGCGT
CACGCAGCTGCTTGCCCTGCAGTACCGGCACGGCCGGAAAGGAATGCTTGCCGGGTATCTGCTCCTGGCC
CTTATGATTTGGCCCCTGCAGCCGGCAAGTTACGGACTGGCAGGAATAACGCTGGCCATCAGTATGGCAA
CGGTTTCTGGCAGCGATACACCCGGAGTGCAGCGGCTGGCAGCCATCACTGCCGTGCTGTCACTGATTTG
TTTAAACGGGTTATCGCATCTCCTGGATATGCCCGCAGAAACATTATTACTGGCCACGCTGCCTACTCTG
GCATTCCCCCTGGCAGTGGTTTCATTCTGCAGGCAAATATGTCCGGAGGGCCGTAGGCGTTTCATGCCGC
GTAATTTCTTTTATTATGCTTACGCCGGCCACCTGGGGATCATTGGTCTGGTACAGACTACTTTTGGCTG
A
 Primer design