SecReT4
Protein ID: 295697986
T4SS name [ID]Tra_F [115]
Gene symbol-
Locus tagECL_A148
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_A [GenBank: NC_014107] [Browse all T4SS(s) in this replicon]
Location [Strand]98231..98533 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDD5CKK2
KEGG IDenc:ECL_A148
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.3e-31, Aligned region: 6..99
Protein Sequence: 100 a.a.     [Download]
>gi|295697986|ref|YP_003602643.1| type IV conjugative transfer system protein TraL [Enterobacter cloacae subsp. cloacae ATCC 13047]
MNGEEDKYNFPETMNQQDRYFGLPVDELIVTAPLLILGVLNNLSVELGVIAGILWFIVRYLKKGQGSYWL
LNFCYWHLPSLLFKVTFRQIPDSSFRHWRA
 
Nucleotide Sequence: 303 bp     [Download]
>gi|295697839|ref|NC_014107.1|:98231-98533 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence
ATGAATGGGGAAGAAGATAAATATAACTTCCCGGAAACAATGAACCAGCAGGACCGCTATTTTGGCTTGC
CAGTTGATGAGTTAATTGTTACCGCACCCCTTCTCATTCTGGGGGTGCTTAACAATCTGTCAGTTGAACT
TGGCGTTATAGCGGGAATCCTCTGGTTCATCGTCAGATATCTGAAAAAAGGGCAGGGGTCGTACTGGTTA
CTTAATTTCTGTTACTGGCACCTGCCATCACTTTTATTCAAAGTAACCTTTCGCCAGATACCTGATTCTA
GTTTCCGGCACTGGAGGGCATAG
 Primer design