SecReT4
Protein ID: 295698008
T4SS name [ID]Tra_F [115]
Gene symbol-
Locus tagECL_A170
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_A [GenBank: NC_014107] [Browse all T4SS(s) in this replicon]
Location [Strand]113316..114098 [+]
Producttype IV conjugative transfer system protein TraF
Component typeTraF_F
UniProt IDD5CKM4
KEGG IDenc:ECL_A170
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.1e-79, Aligned region: 31..250
Protein Sequence: 260 a.a.     [Download]
>gi|295698008|ref|YP_003602665.1| type IV conjugative transfer system protein TraF [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKRVLCGLLMALASHTALADEIVTPAEPFTGWSWYNEPKKPPEQPRKPQQPAPQAIPDLSKMSPMEQARV
LKGYTQEALNRAILYPSRENTATFLRWQKFWTDRASMFSQSFAAAQLSHPDLDYNLEYPHYNSMAPFMQT
RDQQTRQSAVEQLAQQYGLFYFYRGSDPIDVQMAGVVADFAKTNGISLIPVSVDGQVAATLPQSRPDTGQ
SRSMNITHFPALFLVDPRNQNYRALSYGFMTQDDLSKRFLNVATGFKPNS
 
Nucleotide Sequence: 783 bp     [Download]
>gi|295697839|ref|NC_014107.1|:113316-114098 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence
ATGAAGCGTGTCCTCTGTGGCCTGCTTATGGCGCTGGCGAGCCATACGGCACTGGCCGATGAGATTGTGA
CGCCGGCTGAGCCGTTCACCGGCTGGTCCTGGTACAACGAACCGAAAAAGCCCCCTGAGCAGCCCCGGAA
ACCGCAGCAGCCAGCACCGCAGGCCATTCCGGATCTCAGCAAAATGTCCCCGATGGAGCAGGCCAGGGTG
CTGAAAGGGTATACACAGGAGGCGCTTAACCGCGCCATCCTGTACCCCTCAAGGGAAAACACGGCGACGT
TCCTGCGCTGGCAGAAGTTCTGGACGGACCGGGCATCGATGTTCAGCCAGTCCTTTGCGGCGGCGCAGCT
GAGCCATCCGGACCTCGACTACAACCTGGAGTATCCGCACTACAACAGCATGGCGCCGTTTATGCAGACC
CGTGACCAGCAGACGCGGCAGAGCGCCGTGGAGCAGCTTGCGCAGCAGTACGGTCTGTTCTACTTCTACC
GGGGCAGTGACCCGATTGATGTGCAGATGGCGGGCGTGGTGGCTGACTTTGCGAAAACCAACGGGATCTC
ACTCATTCCGGTCTCGGTTGACGGACAGGTGGCGGCCACCCTGCCGCAAAGCCGTCCGGACACCGGACAG
TCCCGGTCGATGAATATCACGCACTTTCCGGCGCTCTTCCTGGTTGACCCGCGCAACCAGAACTACCGTG
CCCTGTCCTATGGCTTCATGACCCAGGATGACCTGTCAAAACGATTCCTGAACGTGGCCACCGGCTTTAA
ACCCAATTCCTGA
 Primer design