SecReT4
Protein ID: 295698177
T4SS name [ID]Tra_F [807]
Gene symbol-
Locus tagECL_B063
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_B [GenBank: NC_014108] [Browse all T4SS(s) in this replicon]
Location [Strand]30751..31032 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDD5CL42
KEGG IDenc:ECL_B063
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 93 a.a.     [Download]
>gi|295698177|ref|YP_003602833.1| hypothetical protein ECL_B063 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MDYGFREGRFFRYPHQPIQIFWFDRDEWMILIACYLASMQLGGFTWAVLFPVSIVIIKIKRTKGRGFFRH
TLYKLGLVEIYGYPNSSAKKLEE
 
Nucleotide Sequence: 282 bp     [Download]
>gi|295698114|ref|NC_014108.1|:30751-31032 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence
ATGGATTACGGATTTAGAGAAGGCCGATTTTTCCGCTACCCCCATCAACCTATTCAGATATTTTGGTTTG
ATAGGGATGAATGGATGATCCTCATTGCTTGTTATCTCGCAAGTATGCAGTTGGGTGGTTTTACCTGGGC
GGTTCTATTCCCCGTATCCATCGTTATTATCAAAATTAAGCGTACTAAAGGCCGGGGGTTCTTCCGTCAT
ACACTCTATAAACTCGGTTTAGTCGAAATATATGGCTACCCAAATTCATCGGCGAAGAAGCTGGAGGAAT
AA
 Primer design