SecReT4
Protein ID: 295698189
T4SS name [ID]Tra_F [807]
Gene symbol-
Locus tagECL_B075
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_B [GenBank: NC_014108] [Browse all T4SS(s) in this replicon]
Location [Strand]44181..45008 [+]
ProductTraF precursor
Component typeTraF_F
UniProt IDD5CL54
KEGG IDenc:ECL_B075
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.6e-31, Aligned region: 33..240
DUF836 [PF05768], Evalue: 1.2e-05, Aligned region: 159..206
Protein Sequence: 275 a.a.     [Download]
>gi|295698189|ref|YP_003602845.1| TraF precursor [Enterobacter cloacae subsp. cloacae ATCC 13047]
MIKEMILVGATLFSFPVLATSDAAAPVKNPRHGLFWYETPKKEEEKKAENKYPRPVIPSADELFKMHPKD
VQDLLDKTRDYALFKLSPDVVLDYYKVQDAARRKSAAFTSLTGYVMLENPQLNAASDYPITNPGNAEKQR
ERQELKSKSLIKNRDEYALLFFSEPNCGFCVQQSRILENFQRETSWYIKEIDITRQPAARKKFNVDRAPV
TILIKRNSDTDKWMPVSVGVDSLDNLRTSIYNMTRVLNGELDPRQFFTNEKQQGGFFDPLKGANK
 
Nucleotide Sequence: 828 bp     [Download]
>gi|295698114|ref|NC_014108.1|:44181-45008 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence
ATGATCAAAGAAATGATACTGGTCGGTGCAACATTGTTTTCATTTCCGGTATTGGCTACCAGTGATGCTG
CTGCACCTGTTAAAAACCCCAGACACGGTTTATTCTGGTATGAGACTCCCAAAAAGGAGGAAGAAAAGAA
GGCAGAAAATAAATATCCACGCCCTGTAATTCCTTCTGCCGATGAACTATTTAAGATGCATCCAAAGGAT
GTTCAGGATTTACTGGATAAAACCAGGGATTACGCACTGTTTAAATTATCCCCTGACGTTGTTCTTGATT
ACTACAAAGTTCAGGATGCTGCACGCAGAAAGTCAGCTGCATTTACCAGCCTGACGGGTTACGTGATGCT
GGAAAATCCCCAACTGAATGCAGCTTCAGATTATCCGATCACGAATCCAGGCAACGCTGAGAAACAGCGC
GAACGTCAGGAGCTTAAAAGTAAAAGTCTGATTAAAAATCGTGATGAATATGCACTGCTTTTCTTTAGCG
AGCCTAATTGTGGTTTCTGCGTACAGCAATCACGTATCCTTGAAAACTTTCAGCGTGAAACCAGCTGGTA
TATCAAAGAAATTGATATTACTCGCCAGCCTGCGGCCAGGAAAAAATTCAACGTTGATCGTGCCCCCGTT
ACCATTCTGATCAAACGCAACTCCGATACGGACAAGTGGATGCCTGTCTCTGTCGGCGTCGATTCGTTAG
ATAACCTCAGAACCAGTATTTACAACATGACTCGCGTACTCAACGGCGAACTTGACCCGCGCCAGTTCTT
TACCAATGAGAAACAGCAGGGCGGATTCTTTGATCCGTTAAAAGGAGCCAATAAATGA
 Primer design