SecReT4
Protein ID: 295701138
T4SS name [ID]Trb [775]
Gene symbol-
Locus tagBC1002_6799
StrainBurkholderia sp. CCGE1002 plasmid pBC201 (NC_014120)
Repliconplasmid pBC201 [GenBank: NC_014120] [Browse all T4SS(s) in this replicon]
Location [Strand]26442..27326 [-]
ProductConjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDD5WP05
KEGG IDbge:BC1002_6799
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-48, Aligned region: 67..286
Protein Sequence: 294 a.a.     [Download]
>gi|295701138|ref|YP_003610139.1| Conjugal transfer protein TrbG/VirB9/CagX [Burkholderia sp. CCGE1002]
MMIDSRTLASWVAALACVTVVCSPVSAAGKGSQVPSAPFDIATAIGDPMSPVNPYNAGTDPITMPGDARM
AVFSYSRDQIYRIMTAPLKTTTIELARGEVLATEPALGDSIQWIVDTDGSNHVFIKPVKPGLVNTLHLTT
NQREYDMTLVSSPMGGLFYQTVRFNYPGSLMAKVRAREDGNPDTTDAGQGGPNANGSGPLGVSPDKLNFD
YTVSGSAPFRPETVFDDGKSVWLRLPANAPFAVPIVRDHGDNVSPNFIRRGQYIVVQEVPDEIVLRAATD
QVTIRRGRPGIFGF
 
Nucleotide Sequence: 885 bp     [Download]
>gi|295701107|ref|NC_014120.1|:c27326-26442 Burkholderia sp. CCGE1002 plasmid pBC201, complete sequence
ATGATGATCGACTCCCGCACGCTCGCCTCGTGGGTCGCGGCTCTTGCCTGCGTCACGGTGGTTTGCTCGC
CAGTGTCTGCTGCAGGGAAGGGCAGCCAGGTTCCGTCCGCACCCTTCGATATCGCCACTGCGATTGGCGA
TCCCATGAGCCCGGTGAATCCGTATAACGCCGGTACCGACCCGATCACCATGCCCGGCGACGCCCGCATG
GCGGTGTTCTCCTATAGCCGCGACCAGATCTACCGCATCATGACTGCGCCGCTCAAGACCACAACGATCG
AGCTGGCGCGCGGAGAAGTCCTGGCGACTGAGCCCGCGCTTGGCGATTCGATCCAGTGGATCGTGGATAC
CGACGGGTCGAACCACGTGTTTATCAAGCCGGTCAAGCCGGGTCTCGTCAACACGCTGCACCTCACGACT
AACCAGCGCGAGTACGACATGACACTCGTCTCCTCGCCGATGGGGGGTCTTTTCTATCAGACCGTGCGGT
TCAACTATCCCGGTTCACTGATGGCCAAGGTTCGCGCGCGCGAGGATGGCAACCCTGACACGACCGATGC
GGGGCAGGGTGGACCCAATGCCAATGGTTCCGGTCCGCTCGGTGTATCGCCTGACAAGCTGAACTTCGAC
TACACGGTATCGGGCTCGGCGCCGTTCCGGCCGGAGACGGTATTCGATGATGGCAAGTCGGTGTGGCTGC
GCCTGCCTGCGAATGCGCCTTTTGCCGTGCCGATCGTCAGGGATCATGGCGACAACGTCAGCCCCAACTT
CATCCGTCGTGGACAGTACATCGTCGTGCAGGAAGTGCCCGACGAGATCGTCCTGCGCGCTGCGACCGAC
CAGGTCACGATCAGGCGCGGTCGTCCCGGCATCTTCGGCTTCTGA
 Primer design