SecReT4
Protein ID: 295701469
T4SS name [ID]Trb [775]
Gene symbol-
Locus tagBC1002_7219
StrainBurkholderia sp. CCGE1002 plasmid pBC201 (NC_014120)
Repliconplasmid pBC201 [GenBank: NC_014120] [Browse all T4SS(s) in this replicon]
Location [Strand]451311..452369 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDD5WNT0
KEGG IDbge:BC1002_7219
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.9e-19, Aligned region: 110..331
Protein Sequence: 352 a.a.     [Download]
>gi|295701469|ref|YP_003610470.1| hypothetical protein BC1002_7219 [Burkholderia sp. CCGE1002]
MRAGLNMLRYLNRLFLTVLVPLCVFACPGFALADEPTTLPDGTVVPASNTPSPSSSGATAASLVKPGELG
QANANAMAKLNAMFAAVVSAAADASQSISQESDKFASGLAVITIVLAAIRFAATKDPVMAWVALFEELGM
LGIFASFYIGYATWVPSFYKWFQTLSSEIAGGTNMGSSVSIIGNAASQLFDSVIKAFKGAAWTEYISVLI
GVIPLLLAWLVLSITAVVFVFYINVGQLQFACGAVMGQIAFALGFSSFTRSYFKSWLDFMITAGMYMVVA
AIMMKLVTGSLVNAVQLATTAGLTTSLSAGYVFDLAFFVFLVSFEIPKIAGMFGGGTGATGGALAKLAKP
LL
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|295701107|ref|NC_014120.1|:c452369-451311 Burkholderia sp. CCGE1002 plasmid pBC201, complete sequence
ATGCGGGCAGGGCTGAACATGCTTCGCTATCTTAACCGGCTTTTTTTGACGGTGCTGGTGCCGCTGTGTG
TGTTCGCGTGTCCAGGGTTTGCGCTTGCAGACGAACCTACGACCCTGCCGGACGGCACCGTGGTGCCCGC
GTCCAATACACCCAGTCCGTCGAGCTCGGGCGCCACGGCTGCCTCGCTGGTCAAGCCGGGAGAACTTGGG
CAGGCCAATGCGAATGCGATGGCGAAGCTCAACGCGATGTTTGCGGCGGTGGTCAGTGCCGCCGCTGATG
CAAGCCAGAGCATCAGCCAGGAATCGGACAAGTTCGCCAGTGGCCTTGCGGTCATCACGATCGTGCTGGC
CGCGATCCGCTTCGCCGCGACGAAAGACCCCGTCATGGCGTGGGTCGCGCTGTTCGAGGAACTCGGGATG
CTCGGCATTTTTGCATCGTTCTACATCGGGTACGCGACCTGGGTGCCATCGTTCTACAAGTGGTTCCAGA
CACTGTCGTCAGAGATTGCCGGTGGCACGAACATGGGCAGTTCGGTCAGCATCATCGGCAATGCCGCCAG
CCAGCTTTTCGACTCGGTCATCAAGGCTTTCAAGGGTGCCGCATGGACCGAGTACATCTCGGTGCTGATC
GGCGTCATTCCGCTCCTTCTTGCGTGGCTCGTCCTGTCGATCACGGCCGTCGTCTTCGTGTTCTACATCA
ACGTGGGGCAGTTGCAGTTCGCGTGCGGCGCGGTGATGGGCCAGATCGCCTTTGCGCTCGGATTCTCATC
GTTTACGCGCAGCTACTTCAAGTCGTGGCTCGACTTCATGATCACCGCGGGCATGTATATGGTCGTGGCC
GCCATCATGATGAAACTCGTCACGGGCAGTCTGGTCAATGCGGTCCAGCTTGCGACCACGGCGGGGTTGA
CCACGTCACTCTCTGCCGGCTACGTCTTCGACCTTGCGTTTTTCGTGTTCCTGGTGTCGTTCGAGATTCC
AAAGATCGCCGGAATGTTCGGGGGCGGCACCGGAGCTACCGGCGGGGCGCTGGCCAAACTCGCGAAGCCG
CTGCTATGA
 Primer design