SecReT4
Protein ID: 295701473
T4SS name [ID]Trb [775]
Gene symbol-
Locus tagBC1002_7223
StrainBurkholderia sp. CCGE1002 plasmid pBC201 (NC_014120)
Repliconplasmid pBC201 [GenBank: NC_014120] [Browse all T4SS(s) in this replicon]
Location [Strand]455885..456277 [-]
Producttype IV secretion system protein
Component typeTrbC
UniProt IDD5WNT4
KEGG IDbge:BC1002_7223
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-05, Aligned region: 32..116
Protein Sequence: 130 a.a.     [Download]
>gi|295701473|ref|YP_003610474.1| type IV secretion system protein [Burkholderia sp. CCGE1002]
MKKYLSEFLATTRERTRALSRLIWTRFLTRRELRSTVVAASLAAFAPFASAVDLTDLGSATDVICLISSY
ISGPWLYGIGIVLIIVGAVAIGNSESTIGKIISTVFVGLGLAACAIPIVKNHLHINYTCA
 
Nucleotide Sequence: 393 bp     [Download]
>gi|295701107|ref|NC_014120.1|:c456277-455885 Burkholderia sp. CCGE1002 plasmid pBC201, complete sequence
ATGAAGAAGTATCTGTCTGAGTTTCTCGCTACCACGCGCGAGCGCACGCGAGCGTTGAGCCGCCTTATCT
GGACGCGCTTCCTCACCCGTCGTGAGCTGCGTTCGACCGTCGTTGCTGCTTCGCTCGCCGCATTCGCGCC
GTTCGCCTCGGCCGTCGACCTGACCGACCTCGGCTCCGCGACGGACGTCATCTGTCTGATCTCGTCCTAC
ATTAGTGGCCCGTGGCTTTACGGCATCGGCATCGTGCTGATCATCGTCGGCGCGGTCGCGATCGGCAATT
CGGAAAGCACCATCGGCAAGATCATTTCGACGGTCTTCGTCGGTCTCGGCCTTGCGGCGTGTGCGATCCC
GATCGTAAAGAACCATCTCCACATCAACTACACATGCGCGTGA
 Primer design